Name | G1/S-specific cyclin-E1 | ||
UniProt ID | CCNE1_HUMAN | ||
Gene Name | CCNE1 | ||
Gene ID | 898 | ||
Synonyms |
CCNE1, CCNE, pCCNE1
|
||
Sequence |
MPRERRERDAKERDTMKEDGGAEFSARSRKRKANVTVFLQDPDEEMAKIDRTARDQCGSQ
PWDNNAVCADPCSLIPTPDKEDDDRVYPNSTCKPRIIAPSRGSPLPVLSWANREEVWKIM LNKEKTYLRDQHFLEQHPLLQPKMRAILLDWLMEVCEVYKLHRETFYLAQDFFDRYMATQ ENVVKTLLQLIGISSLFIAAKLEEIYPPKLHQFAYVTDGACSGDEILTMELMIMKALKWR LSPLTIVSWLNVYMQVAYLNDLHEVLLPQYPQQIFIQIAELLDLCVLDVDCLEFPYGILA ASALYHFSSSELMQKVSGYQWCDIENCVKWMVPFAMVIRETGSSKLKHFRGVADEDAHNI QTHRDSLDLLDKARAKKAMLSEQNRASPLPSGLLTPPQSGKKQSSGPEMA |
||
Pathway Map | MAP LINK | ||
KEGG ID | hsa898 | ||
TTD ID | T10052 | ||
Pfam | PF00134; PF02984 |
Pair Name | Usnic acid, Bleomycin | |||
Phytochemical Name | Usnic acid | |||
Anticancer drug Name | Bleomycin | |||
Disease Info | [ICD-11: 2F94] | Ascitic tumor | Investigative | |
Regulate Info | Down-regulation | G1/S-specific cyclin-E1 | Expression | |
Result | Effect-enhancing and toxicity-reducing activity of usnic acid in ascitic tumor-bearing mice treated with bleomycin |
Pair Name | AKBA, Cisplatin | |||
Phytochemical | AKBA | |||
Drug | Cisplatin | |||
Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
Regulate Info | Down-regulation | G1/S-specific cyclin-E1 | Expression | |
Result | Acetyl-11-keto-beta-boswellic acid enhances the cisplatin sensitivity of non-small cell lung cancer cells through cell cycle arrest, apoptosis induction, and autophagy suppression via p21-dependent signaling pathway |
Pair Name | Berbamine, Arcyriaflavin A | |||
Phytochemical | Berbamine | |||
Drug | Arcyriaflavin A | |||
Disease Info | [ICD-11: 2A00] | Glioblastoma multiforme | Investigative | |
Regulate Info | Down-regulation | G1/S-specific cyclin-E1 | Expression | |
Result | Our findings suggest that a novel combination therapy involving berbamine and ArcA could effectively eradicate glioblastoma stem-like cells. |
Pair Name | Daurinoline, Sorafenib | |||
Phytochemical | Daurinoline | |||
Drug | Sorafenib | |||
Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
Regulate Info | Down-regulation | G1/S-specific cyclin-E1 | Expression | |
Result | Our study provides insights into the molecular mechanisms underlying DS-induced inhibition of VM, which may facilitate the development of a novel clinical anti-HCC drug. Moreover, our findings suggest that the combination of DS and sorafenib constitutes a potential therapeutic strategy for HCC. |
Pair Name | Dihydroberberine, Sunitinib | |||
Phytochemical | Dihydroberberine | |||
Drug | Sunitinib | |||
Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
Regulate Info | Down-regulation | G1/S-specific cyclin-E1 | Expression | |
Result | DCS induced the expression of cell cycle signal molecules that are known to be affected by JNK and p38. The change of cell cycle, in turn, led to down-regulation of JNK and p38, and further reduced IL-1 secretion. Collectively, these findings highlight potential molecular mechanisms of DCS chemotherapeutic activity and suggest that DCS is an efficacious strategy in NSCLC therapy. |
Pair Name | Honokiol, Rosiglitazone | |||
Phytochemical | Honokiol | |||
Drug | Rosiglitazone | |||
Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
Regulate Info | Down-regulation | G1/S-specific cyclin-E1 | Expression | |
Result | Honokiol combined with rosiglitazone showed more effective growth inhibition in hepatoma cells mediated through the regulation of G0/G1 phase-related proteins p21, cyclin D1, cyclin E1, and Rb and cell cycle progression |
Pair Name | Patchouli alcohol, Vincristine | |||
Phytochemical | Patchouli alcohol | |||
Drug | Vincristine | |||
Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
Regulate Info | Down-regulation | G1/S-specific cyclin-E1 | Expression | |
Result | Patchouli alcohol induces G0 /G1 cell cycle arrest and apoptosis in vincristine-resistant non-small cell lung cancer through ROS-mediated DNA damage |
Pair Name | Shogaol, Fluorouracil | |||
Phytochemical | Shogaol | |||
Drug | Fluorouracil | |||
Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
Regulate Info | Down-regulation | G1/S-specific cyclin-E1 | Expression | |
Result | Influence of 6-shogaol potentiated on 5-fluorouracil treatment of liver cancer by promoting apoptosis and cell cycle arrest by regulating AKT/mTOR/MRP1 signalling |
Pair Name | Ursolic acid, Cisplatin | |||
Phytochemical | Ursolic acid | |||
Drug | Cisplatin | |||
Disease Info | [ICD-11: 2C77] | Cervical cancer | Investigative | |
Regulate Info | Down-regulation | G1/S-specific cyclin-E1 | Expression | |
Result | The combination of UA with DDP could more effectively inhibit SiHa cells proliferation and facilitate cell apoptosis through suppressing NF-κB p65. |
Pair Name | Polyphyllin I, Palbociclib | |||
Phytochemical | Polyphyllin I | |||
Drug | Palbociclib | |||
Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
Regulate Info | Down-regulation | G1/S-specific cyclin-E1 | Expression | |
Result | We first time demonstrated PPI can disturb CDK2 function through upregulation of p21. The PPI effect on CDK2 provides a choice for a chemotherapeutic strategy for the elimination of NSCLC. Our study highlighted the clinical significance of simultaneously blocking of CDK2 and CDK4/6 for NSCLC treatment. |
No. | Title | Href |
---|---|---|
1 | Effect-enhancing and toxicity-reducing activity of usnic acid in ascitic tumor-bearing mice treated with bleomycin. Int Immunopharmacol. 2017 May;46:146-155. doi: 10.1016/j.intimp.2017.03.004. | Click |
2 | Acetyl-11-keto-β-boswellic acid enhances the cisplatin sensitivity of non-small cell lung cancer cells through cell cycle arrest, apoptosis induction, and autophagy suppression via p21-dependent signaling pathway. Cell Biol Toxicol. 2021 Apr;37(2):209-228. doi: 10.1007/s10565-020-09541-5. | Click |
3 | Synergistic Anticancer Effect of a Combination of Berbamine and Arcyriaflavin A against Glioblastoma Stem-like Cells. Molecules. 2022 Nov 17;27(22):7968. doi: 10.3390/molecules27227968. | Click |
4 | The role of daurisoline treatment in hepatocellular carcinoma: Inhibiting vasculogenic mimicry formation and enhancing sensitivity to sorafenib. Phytomedicine. 2021 Nov;92:153740. doi: 10.1016/j.phymed.2021.153740. | Click |
5 | Dihydroberberine exhibits synergistic effects with sunitinib on NSCLC NCI-H460 cells by repressing MAP kinase pathways and inflammatory mediators. J Cell Mol Med. 2017 Oct;21(10):2573-2585. doi: 10.1111/jcmm.13178. | Click |
6 | Combined effect of honokiol and rosiglitazone on cell growth inhibition through enhanced G0/G1 phase arrest in hepatoma cells. J Chin Med Assoc. 2016 Aug;79(8):415-21. doi: 10.1016/j.jcma.2016.03.003. | Click |
7 | Patchouli alcohol induces G0 /G1 cell cycle arrest and apoptosis in vincristine-resistant non-small cell lung cancer through ROS-mediated DNA damage. Thorac Cancer. 2023 Jul;14(21):2007-2017. doi: 10.1111/1759-7714.14982. | Click |
8 | Influence of 6-shogaol potentiated on 5-fluorouracil treatment of liver cancer by promoting apoptosis and cell cycle arrest by regulating AKT/mTOR/MRP1 signalling. Chin J Nat Med. 2022 May;20(5):352-363. doi: 10.1016/S1875-5364(22)60174-2. | Click |
9 | Synergism of ursolic acid and cisplatin promotes apoptosis and enhances growth inhibition of cervical cancer cells via suppressing NF-κB p65. Oncotarget. 2017 Oct 30;8(57):97416-97427. doi: 10.18632/oncotarget.22133. | Click |
10 | Polyphyllin I, a lethal partner of Palbociclib, suppresses non-small cell lung cancer through activation of p21/CDK2/Rb pathway in vitro and in vivo. Cell Cycle. 2021 Dec;20(23):2494-2506. doi: 10.1080/15384101.2021.1991121. | Click |