TOP
Nav Bar
  1. General Info
  2. Effects Info
  3. Reference
Molecular Details
01. General Information
Name G1/S-specific cyclin-E1
UniProt ID CCNE1_HUMAN
Gene Name CCNE1
Gene ID 898
Synonyms
CCNE1, CCNE, pCCNE1
Sequence
MPRERRERDAKERDTMKEDGGAEFSARSRKRKANVTVFLQDPDEEMAKIDRTARDQCGSQ
PWDNNAVCADPCSLIPTPDKEDDDRVYPNSTCKPRIIAPSRGSPLPVLSWANREEVWKIM
LNKEKTYLRDQHFLEQHPLLQPKMRAILLDWLMEVCEVYKLHRETFYLAQDFFDRYMATQ
ENVVKTLLQLIGISSLFIAAKLEEIYPPKLHQFAYVTDGACSGDEILTMELMIMKALKWR
LSPLTIVSWLNVYMQVAYLNDLHEVLLPQYPQQIFIQIAELLDLCVLDVDCLEFPYGILA
ASALYHFSSSELMQKVSGYQWCDIENCVKWMVPFAMVIRETGSSKLKHFRGVADEDAHNI
QTHRDSLDLLDKARAKKAMLSEQNRASPLPSGLLTPPQSGKKQSSGPEMA
Pathway Map MAP LINK
KEGG ID hsa898
TTD ID T10052
Pfam PF00134; PF02984
02. Combinatorial Therapeutic Effect(s)
Synergistic Effect
Hide/Show
Decreasing Drug Toxicity
Hide/Show
Combination Pair ID: 503
Pair Name Usnic acid, Bleomycin
Phytochemical Name Usnic acid
Anticancer drug Name Bleomycin
Disease Info [ICD-11: 2F94] Ascitic tumor Investigative
Regulate Info Down-regulation G1/S-specific cyclin-E1 Expression
Result Effect-enhancing and toxicity-reducing activity of usnic acid in ascitic tumor-bearing mice treated with bleomycin
Enhancing Drug Efficacy
Hide/Show
Combination Pair ID: 31
Pair Name Berbamine, Arcyriaflavin A
Phytochemical Berbamine
Drug Arcyriaflavin A
Disease Info [ICD-11: 2A00] Glioblastoma multiforme Investigative
Regulate Info Down-regulation G1/S-specific cyclin-E1 Expression
Result Our findings suggest that a novel combination therapy involving berbamine and ArcA could effectively eradicate glioblastoma stem-like cells.
Combination Pair ID: 47
Pair Name Dihydroberberine, Sunitinib
Phytochemical Dihydroberberine
Drug Sunitinib
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Down-regulation G1/S-specific cyclin-E1 Expression
Result DCS induced the expression of cell cycle signal molecules that are known to be affected by JNK and p38. The change of cell cycle, in turn, led to down-regulation of JNK and p38, and further reduced IL-1 secretion. Collectively, these findings highlight potential molecular mechanisms of DCS chemotherapeutic activity and suggest that DCS is an efficacious strategy in NSCLC therapy.
Combination Pair ID: 53
Pair Name Daurinoline, Sorafenib
Phytochemical Daurinoline
Drug Sorafenib
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Down-regulation G1/S-specific cyclin-E1 Expression
Result Our study provides insights into the molecular mechanisms underlying DS-induced inhibition of VM, which may facilitate the development of a novel clinical anti-HCC drug. Moreover, our findings suggest that the combination of DS and sorafenib constitutes a potential therapeutic strategy for HCC.
Combination Pair ID: 681
Pair Name Ursolic acid, Cisplatin
Phytochemical Ursolic acid
Drug Cisplatin
Disease Info [ICD-11: 2C77.Z] Cervical cancer Investigative
Regulate Info Down-regulation G1/S-specific cyclin-E1 Expression
Result The combination of UA with DDP could more effectively inhibit SiHa cells proliferation and facilitate cell apoptosis through suppressing NF-κB p65.
Combination Pair ID: 232
Pair Name AKBA, Cisplatin
Phytochemical AKBA
Drug Cisplatin
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Down-regulation G1/S-specific cyclin-E1 Expression
Result Acetyl-11-keto-beta-boswellic acid enhances the cisplatin sensitivity of non-small cell lung cancer cells through cell cycle arrest, apoptosis induction, and autophagy suppression via p21-dependent signaling pathway
Combination Pair ID: 1033
Pair Name Patchouli alcohol, Vincristine
Phytochemical Patchouli alcohol
Drug Vincristine
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Down-regulation G1/S-specific cyclin-E1 Expression
Result Patchouli alcohol induces G0 /G1 cell cycle arrest and apoptosis in vincristine-resistant non-small cell lung cancer through ROS-mediated DNA damage
Combination Pair ID: 766
Pair Name Honokiol, Rosiglitazone
Phytochemical Honokiol
Drug Rosiglitazone
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Down-regulation G1/S-specific cyclin-E1 Expression
Result Honokiol combined with rosiglitazone showed more effective growth inhibition in hepatoma cells mediated through the regulation of G0/G1 phase-related proteins p21, cyclin D1, cyclin E1, and Rb and cell cycle progression
Combination Pair ID: 460
Pair Name Shogaol, Fluorouracil
Phytochemical Shogaol
Drug Fluorouracil
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Down-regulation G1/S-specific cyclin-E1 Expression
Result Influence of 6-shogaol potentiated on 5-fluorouracil treatment of liver cancer by promoting apoptosis and cell cycle arrest by regulating AKT/mTOR/MRP1 signalling
Reversing Drug Resistance
Hide/Show
Combination Pair ID: 58
Pair Name Polyphyllin I, Palbociclib
Phytochemical Polyphyllin I
Drug Palbociclib
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Down-regulation G1/S-specific cyclin-E1 Expression
Result We first time demonstrated PPI can disturb CDK2 function through upregulation of p21. The PPI effect on CDK2 provides a choice for a chemotherapeutic strategy for the elimination of NSCLC. Our study highlighted the clinical significance of simultaneously blocking of CDK2 and CDK4/6 for NSCLC treatment.
03. Reference
No. Title Href
1 Effect-enhancing and toxicity-reducing activity of usnic acid in ascitic tumor-bearing mice treated with bleomycin. Int Immunopharmacol. 2017 May;46:146-155. doi: 10.1016/j.intimp.2017.03.004. Click
2 Synergistic Anticancer Effect of a Combination of Berbamine and Arcyriaflavin A against Glioblastoma Stem-like Cells. Molecules. 2022 Nov 17;27(22):7968. doi: 10.3390/molecules27227968. Click
3 Dihydroberberine exhibits synergistic effects with sunitinib on NSCLC NCI-H460 cells by repressing MAP kinase pathways and inflammatory mediators. J Cell Mol Med. 2017 Oct;21(10):2573-2585. doi: 10.1111/jcmm.13178. Click
4 The role of daurisoline treatment in hepatocellular carcinoma: Inhibiting vasculogenic mimicry formation and enhancing sensitivity to sorafenib. Phytomedicine. 2021 Nov;92:153740. doi: 10.1016/j.phymed.2021.153740. Click
5 Synergism of ursolic acid and cisplatin promotes apoptosis and enhances growth inhibition of cervical cancer cells via suppressing NF-κB p65. Oncotarget. 2017 Oct 30;8(57):97416-97427. doi: 10.18632/oncotarget.22133. Click
6 Acetyl-11-keto-β-boswellic acid enhances the cisplatin sensitivity of non-small cell lung cancer cells through cell cycle arrest, apoptosis induction, and autophagy suppression via p21-dependent signaling pathway. Cell Biol Toxicol. 2021 Apr;37(2):209-228. doi: 10.1007/s10565-020-09541-5. Click
7 Patchouli alcohol induces G0 /G1 cell cycle arrest and apoptosis in vincristine-resistant non-small cell lung cancer through ROS-mediated DNA damage. Thorac Cancer. 2023 Jul;14(21):2007-2017. doi: 10.1111/1759-7714.14982. Click
8 Combined effect of honokiol and rosiglitazone on cell growth inhibition through enhanced G0/G1 phase arrest in hepatoma cells. J Chin Med Assoc. 2016 Aug;79(8):415-21. doi: 10.1016/j.jcma.2016.03.003. Click
9 Influence of 6-shogaol potentiated on 5-fluorouracil treatment of liver cancer by promoting apoptosis and cell cycle arrest by regulating AKT/mTOR/MRP1 signalling. Chin J Nat Med. 2022 May;20(5):352-363. doi: 10.1016/S1875-5364(22)60174-2. Click
10 Polyphyllin I, a lethal partner of Palbociclib, suppresses non-small cell lung cancer through activation of p21/CDK2/Rb pathway in vitro and in vivo. Cell Cycle. 2021 Dec;20(23):2494-2506. doi: 10.1080/15384101.2021.1991121. Click
It has been 419959 visits since 2024.08
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang
TOP