TOP
Nav Bar
  1. General Info
  2. Effects Info
  3. Reference
Molecular Details
01. General Information
Name Cyclic AMP-dependent transcription factor ATF-4
UniProt ID ATF4_HUMAN
Gene Name ATF4
Gene ID 468
Synonyms
ATF4, CREB-2, CREB2, TAXREB67, TXREB
Sequence
MTEMSFLSSEVLVGDLMSPFDQSGLGAEESLGLLDDYLEVAKHFKPHGFSSDKAKAGSSE
WLAVDGLVSPSNNSKEDAFSGTDWMLEKMDLKEFDLDALLGIDDLETMPDDLLTTLDDTC
DLFAPLVQETNKQPPQTVNPIGHLPESLTKPDQVAPFTFLQPLPLSPGVLSSTPDHSFSL
ELGSEVDITEGDRKPDYTAYVAMIPQCIKEEDTPSDNDSGICMSPESYLGSPQHSPSTRG
SPNRSLPSPGVLCGSARPKPYDPPGEKMVAAKVKGEKLDKKLKKMEQNKTAATRYRQKKR
AEQEALTGECKELEKKNEALKERADSLAKEIQYLKDLIEEVRKARGKKRVP
Pathway Map MAP LINK
T.C. Number 8.A.23.1.57
KEGG ID hsa468
TTD ID T53270
Pfam PF00170; PF03131; PF06009; PF07716; PF07767; PF11932; PF13166; PF13830; PF14362
02. Combinatorial Therapeutic Effect(s)
Synergistic Effect
Hide/Show
Enhancing Drug Efficacy
Hide/Show
Combination Pair ID: 969
Pair Name Piperlongumine, HSP90 inhibitors
Phytochemical Piperlongumine
Drug HSP90 inhibitors
Disease Info [ICD-11: 2B90.Z] Colon cancer Investigative
Regulate Info Up-regulation Cyclic AMP-dependent transcription factor ATF-4 Expression
Result Combination therapy with HSP90 inhibitors and piperlongumine promotes ROS-mediated ER stress in colon cancer cells
Combination Pair ID: 970
Pair Name Piperlongumine, Bortezomib
Phytochemical Piperlongumine
Drug Bortezomib
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Up-regulation Cyclic AMP-dependent transcription factor ATF-4 Expression
Result Piperlongumine and bortezomib synergically inhibit cholangiocarcinoma via ER stress-induced cell death
Combination Pair ID: 166
Pair Name Dihydroartemisinin, Oxaliplatin
Phytochemical Dihydroartemisinin
Drug Oxaliplatin
Disease Info [ICD-11: 2B91.Z] Colorectal cancer Investigative
Regulate Info Up-regulation Cyclic AMP-dependent transcription factor ATF-4 Expression
Result We demonstrated an improved therapeutic strategy for CRC patients by combining DHA and oxaliplatin treatments.
Combination Pair ID: 723
Pair Name Shikonin, Osimertinib
Phytochemical Shikonin
Drug Osimertinib
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation Cyclic AMP-dependent transcription factor ATF-4 Expression
Result Shikonin increased the anticancer activity of AZD9291 in primary wtEGFR NSCLC cells through ROS-mediated ER stress
Combination Pair ID: 336
Pair Name Decursin, TNF-related apoptosis inducing ligand
Phytochemical Decursin
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation Cyclic AMP-dependent transcription factor ATF-4 Activity
Result ROS generation by decursin selectively activated the PERK/ATF4 axis of the endoplasmic reticulum stress signalling pathway, leading to enhanced TRAIL sensitivity in TRAIL-resistant NSCLC cell lines, partly via up-regulation of DR5.
Combination Pair ID: 349
Pair Name Ursodiol, Bortezomib
Phytochemical Ursodiol
Drug Bortezomib
Disease Info [ICD-11: 2A00] Glioblastoma multiforme Investigative
Regulate Info Up-regulation Cyclic AMP-dependent transcription factor ATF-4 Expression
Result Ursodeoxycholic Acid Inhibits Glioblastoma Progression via Endoplasmic Reticulum Stress Related Apoptosis and Synergizes with the Proteasome Inhibitor Bortezomib
Combination Pair ID: 355
Pair Name Withaferin A, Fluorouracil
Phytochemical Withaferin A
Drug Fluorouracil
Disease Info [ICD-11: 2B91.Z] Colorectal cancer Investigative
Regulate Info Up-regulation Cyclic AMP-dependent transcription factor ATF-4 Expression
Result Synergistic antitumor effect of 5-fluorouracil and withaferin-A induces endoplasmic reticulum stress-mediated autophagy and apoptosis in colorectal cancer cells
Combination Pair ID: 375
Pair Name Resveratrol, Cisplatin
Phytochemical Resveratrol
Drug Cisplatin
Disease Info [ICD-11: 2B72.Z] Gastric cancer Investigative
Regulate Info Up-regulation Cyclic AMP-dependent transcription factor ATF-4 Activity
Result These results indicated that RES is a promising adjuvant for DDP during GC chemotherapy.
Combination Pair ID: 420
Pair Name Anacardic Acid, Bortezomib
Phytochemical Anacardic Acid
Drug Bortezomib
Disease Info [ICD-11: 2A83.1] Multiple myeloma Investigative
Regulate Info Up-regulation Cyclic AMP-dependent transcription factor ATF-4 Expression
Result The results of the present study suggest that AA/Bor combination may be a potential therapeutic strategy for MM treatment.
Combination Pair ID: 461
Pair Name Shogaol, Gefitinib
Phytochemical Shogaol
Drug Gefitinib
Disease Info [ICD-11: 2C73] Ovarian Cancer Investigative
Regulate Info Up-regulation Cyclic AMP-dependent transcription factor ATF-4 Expression
Result Our results suggest that 6-shogaol exerts a potential anti-cancer effect in ovarian cancer and combination treatment with 6-shogaol and gefitinib may provide a novel anti-tumor therapeutic strategy in gefitinib-resistant ovarian cancer.
Combination Pair ID: 894
Pair Name Tannic acid, Cisplatin
Phytochemical Tannic acid
Drug Cisplatin
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation Cyclic AMP-dependent transcription factor ATF-4 Expression
Result The combination of TA and CDDP may produce synergistic antitumoral effects mediated by the PERK-ATF4-CHOP apoptotic axis, suggesting a novel adjuvant treatment for lung cancer.
Combination Pair ID: 569
Pair Name Zerumbone, Celecoxib
Phytochemical Zerumbone
Drug Celecoxib
Disease Info [ICD-11: 2B90.Z] Colon cancer Investigative
Regulate Info Up-regulation Cyclic AMP-dependent transcription factor ATF-4 Expression
Result Our results provide novel insights into the role of ATF3 as an essential transcription factor for p53-independent DR5 induction upon both ZER and CCB treatment, and this may be a useful biomarker for TRAIL-based anticancer therapy.
Reversing Drug Resistance
Hide/Show
Combination Pair ID: 316
Pair Name Honokiol, Paclitaxel
Phytochemical Honokiol
Drug Paclitaxel
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation Cyclic AMP-dependent transcription factor ATF-4 Expression
Result Synergistic killing effect of paclitaxel and honokiol in non-small cell lung cancer cells through paraptosis induction
03. Reference
No. Title Href
1 Combination therapy with HSP90 inhibitors and piperlongumine promotes ROS-mediated ER stress in colon cancer cells. Cell Death Discov. 2023 Oct 13;9(1):375. doi: 10.1038/s41420-023-01672-y. Click
2 Piperlongumine and bortezomib synergically inhibit cholangiocarcinoma via ER stress-induced cell death. Naunyn Schmiedebergs Arch Pharmacol. 2023 Jan;396(1):109-120. doi: 10.1007/s00210-022-02305-4. Click
3 Dihydroartemisinin enhances the anti-tumor activity of oxaliplatin in colorectal cancer cells by altering PRDX2-reactive oxygen species-mediated multiple signaling pathways. Phytomedicine. 2022 Apr;98:153932. doi: 10.1016/j.phymed.2022.153932. Click
4 A natural anthraquinone derivative shikonin synergizes with AZD9291 against wtEGFR NSCLC cells through reactive oxygen species-mediated endoplasmic reticulum stress. Phytomedicine. 2020 Mar;68:153189. doi: 10.1016/j.phymed.2020.153189. Click
5 Decursin enhances TRAIL-induced apoptosis through oxidative stress mediated- endoplasmic reticulum stress signalling in non-small cell lung cancers. Br J Pharmacol. 2016 Mar;173(6):1033-44. doi: 10.1111/bph.13408. Click
6 Ursodeoxycholic Acid Inhibits Glioblastoma Progression via Endoplasmic Reticulum Stress Related Apoptosis and Synergizes with the Proteasome Inhibitor Bortezomib. ACS Chem Neurosci. 2020 May 6;11(9):1337-1346. doi: 10.1021/acschemneuro.0c00095. Click
7 Synergistic antitumor effect of 5-fluorouracil and withaferin-A induces endoplasmic reticulum stress-mediated autophagy and apoptosis in colorectal cancer cells. Am J Cancer Res. 2020 Mar 1;10(3):799-815. Click
8 Resveratrol synergizes with cisplatin in antineoplastic effects against AGS gastric cancer cells by inducing endoplasmic reticulum stress‑mediated apoptosis and G2/M phase arrest. Oncol Rep. 2020 Oct;44(4):1605-1615. doi: 10.3892/or.2020.7708. Click
9 Combined therapeutic effects of bortezomib and anacardic acid on multiple myeloma cells via activation of the endoplasmic reticulum stress response. Mol Med Rep. 2016 Sep;14(3):2679-84. doi: 10.3892/mmr.2016.5533. Click
10 6-Shogaol Overcomes Gefitinib Resistance via ER Stress in Ovarian Cancer Cells. Int J Mol Sci. 2023 Jan 30;24(3):2639. doi: 10.3390/ijms24032639. Click
11 Synergistic anticancer activity of cisplatin combined with tannic acid enhances apoptosis in lung cancer through the PERK-ATF4 pathway. Eur J Med Res. 2023 Oct 27;28(1):462. doi: 10.1186/s40001-023-01420-z. Click
12 Role of activating transcription factor 3 (ATF3) in endoplasmic reticulum (ER) stress-induced sensitization of p53-deficient human colon cancer cells to tumor necrosis factor (TNF)-related apoptosis-inducing ligand (TRAIL)-mediated apoptosis through up-regulation of death receptor 5 (DR5) by zerumbone and celecoxib. J Biol Chem. 2014 Aug 1;289(31):21544-61. doi: 10.1074/jbc.M114.558890. Click
13 Synergistic killing effect of paclitaxel and honokiol in non-small cell lung cancer cells through paraptosis induction. Cell Oncol (Dordr). 2021 Feb;44(1):135-150. doi: 10.1007/s13402-020-00557-x. Click
It has been 511989 visits since 2024.08
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang
TOP