Name | Broad substrate specificity ATP-binding cassette transporter ABCG2 | ||
UniProt ID | ABCG2_HUMAN | ||
Gene Name | ABCG2 | ||
Gene ID | 9429 | ||
Synonyms |
ABCG2, ABC15, ABCP, BCRP, BCRP1, BMDP, CD338, CDw338, CDw388, EST157481, GOUT1, MRX, MXR, MXR-1, MXR1, UAQTL1
|
||
Sequence |
MSSSNVEVFIPVSQGNTNGFPATASNDLKAFTEGAVLSFHNICYRVKLKSGFLPCRKPVE
KEILSNINGIMKPGLNAILGPTGGGKSSLLDVLAARKDPSGLSGDVLINGAPRPANFKCN SGYVVQDDVVMGTLTVRENLQFSAALRLATTMTNHEKNERINRVIQELGLDKVADSKVGT QFIRGVSGGERKRTSIGMELITDPSILFLDEPTTGLDSSTANAVLLLLKRMSKQGRTIIF SIHQPRYSIFKLFDSLTLLASGRLMFHGPAQEALGYFESAGYHCEAYNNPADFFLDIING DSTAVALNREEDFKATEIIEPSKQDKPLIEKLAEIYVNSSFYKETKAELHQLSGGEKKKK ITVFKEISYTTSFCHQLRWVSKRSFKNLLGNPQASIAQIIVTVVLGLVIGAIYFGLKNDS TGIQNRAGVLFFLTTNQCFSSVSAVELFVVEKKLFIHEYISGYYRVSSYFLGKLLSDLLP MRMLPSIIFTCIVYFMLGLKPKADAFFVMMFTLMMVAYSASSMALAIAAGQSVVSVATLL MTICFVFMMIFSGLLVNLTTIASWLSWLQYFSIPRYGFTALQHNEFLGQNFCPGLNATGN NPCNYATCTGEEYLVKQGIDLSPWGLWKNHVALACMIVIFLTIAYLKLLFLKKYS |
||
Pathway Map | MAP LINK | ||
T.C. Number | 3.A.1.204.2 | ||
KEGG ID | hsa9429 | ||
TTD ID | T56556 | ||
Pfam | PF00005; PF01061; PF02463; PF03193; PF13304; PF13476; PF13555; PF19055 |
Pair Name | Tanshinone IIA, Doxorubicin | |||
Phytochemical Name | Tanshinone IIA | |||
Anticancer drug Name | Doxorubicin | |||
Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
Regulate Info | Down-regulation | Broad substrate specificity ATP-binding cassette transporter ABCG2 | Expression | |
Result | Tan IIA could be used as a novel agent combined with Dox in breast cancer therapy. |
Pair Name | Curcumin, Quinacrine | |||
Phytochemical Name | Curcumin | |||
Anticancer drug Name | Quinacrine | |||
Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
Regulate Info | Down-regulation | Broad substrate specificity ATP-binding cassette transporter ABCG2 | Expression | |
Result | Quinacrine and Curcumin in combination decreased the breast cancer angiogenesis by modulating ABCG2 via VEGF A |
Pair Name | Carvacrol, Sorafenib | |||
Phytochemical Name | Carvacrol | |||
Anticancer drug Name | Sorafenib | |||
Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
Regulate Info | Down-regulation | Broad substrate specificity ATP-binding cassette transporter ABCG2 | Expression | |
Result | CARV/Sora is a promising combination for tumor suppression and overcoming Sora resistance and cardiotoxicity in HCC by modulating TRPM7. To our best knowledge, this study represents the first study to investigate the efficiency of CARV/ Sora on the HCC rat model. Moreover, no previous studies have reported the effect of inhibiting TRPM7 on HCC. |
Pair Name | Camptothecin, Sorafenib | |||
Phytochemical | Camptothecin | |||
Drug | Sorafenib | |||
Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
Regulate Info | Down-regulation | Broad substrate specificity ATP-binding cassette transporter ABCG2 | Expression | |
Result | The synergetic combination significantly increases lipid peroxidation and iron concentration, decreases TAC, GPX4 and GR activity, and reduces the expression of both Nrf2 and SLC7A11. The downregulation of Nrf2 expression has a vital role in the reduction of resistance mediators to sorafenib against HCC cells like (p62, MT1G, and ABCG2) and improves the cellular uptake of sorafenib. The current study provided evidence that Nrf2 inhibition by CPT improves sorafenib's sensitivity and reduces sorafenib's resistance via the augmentation of sorafenib's ferroptosis action. |
Pair Name | Daidzein, Topotecan | |||
Phytochemical | Daidzein | |||
Drug | Topotecan | |||
Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
Regulate Info | Down-regulation | Broad substrate specificity ATP-binding cassette transporter ABCG2 | Expression | |
Result | Daidzein enhances the anticancer effect of topotecan and reverses BCRP-mediated drug resistance in breast cancer. |
Pair Name | Ursolic acid, Cisplatin | |||
Phytochemical | Ursolic acid | |||
Drug | Cisplatin | |||
Disease Info | [ICD-11: 2C73] | Ovarian cancer | Investigative | |
Regulate Info | Down-regulation | Broad substrate specificity ATP-binding cassette transporter ABCG2 | Expression | |
Result | UA inhibits the proliferation and reversal of drug resistance in ovarian CSCs by suppressing the expression of downregulation of HIF-1α and ABCG2. |
Pair Name | Curcumol, Cisplatin | |||
Phytochemical | Curcumol | |||
Drug | Cisplatin | |||
Disease Info | [ICD-11: 2B51] | Osteosarcoma | Investigative | |
Regulate Info | Down-regulation | Broad substrate specificity ATP-binding cassette transporter ABCG2 | Expression | |
Result | These findings suggest that curcumol inhibits the polarization of M2-like macrophages and could be a promising combination strategy to synergize with CDDP in the osteosarcoma. |
Pair Name | Thymoquinone, Imatinib | |||
Phytochemical | Thymoquinone | |||
Drug | Imatinib | |||
Disease Info | [ICD-11: 2B90.Z] | Colon cancer | Investigative | |
Regulate Info | Down-regulation | Broad substrate specificity ATP-binding cassette transporter ABCG2 | Expression | |
Result | TQ potentiates IM efficacy on HCT116 cells via uptake/efflux genes modulation |
Pair Name | Fucoxanthin, Doxorubicin | |||
Phytochemical | Fucoxanthin | |||
Drug | Doxorubicin | |||
Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
Regulate Info | Down-regulation | Broad substrate specificity ATP-binding cassette transporter ABCG2 | Expression | |
Result | The carotenoid fucoxanthin can sensitize multidrug resistant cancer cells to doxorubicin via induction of apoptosis, inhibition of multidrug resistance proteins and metabolic enzymes |
Pair Name | Fisetin, Paclitaxel | |||
Phytochemical | Fisetin | |||
Drug | Paclitaxel | |||
Disease Info | [ICD-11: 2C73] | Ovarian cancer | Investigative | |
Regulate Info | Down-regulation | Broad substrate specificity ATP-binding cassette transporter ABCG2 | Expression | |
Result | Our study shows that PTX-FA and Fis-FA PBM NPs directly target platinum-resistant OvCa cells, induce cytotoxic/apoptotic effects, and reverse multi-drug resistance (MDR). These findings allow us to create new clinical applications using PTX-FA and Fis-FA combination nanoparticles to treat drug-resistant cancers. |
Pair Name | Celastrol, Cisplatin | |||
Phytochemical | Celastrol | |||
Drug | Cisplatin | |||
Disease Info | [ICD-11: 2B72.Z] | Gastric cancer | Investigative | |
Regulate Info | Down-regulation | Broad substrate specificity ATP-binding cassette transporter ABCG2 | Expression | |
Result | Celastrol can inhibit the proliferation of the SGC7901/DDP cells, induce their apoptosis, and reduce the expression of drug resistance genes, probably by inhibiting the expression of the proteins related to the mTOR signaling pathway |
Pair Name | Saikosaponin D, Gefitinib | |||
Phytochemical | Saikosaponin D | |||
Drug | Gefitinib | |||
Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
Regulate Info | Down-regulation | Broad substrate specificity ATP-binding cassette transporter ABCG2 | Expression | |
Result | Saikosaponin D enhances the antitumor effect of gemcitabine by controlling glucose metabolism and drug efflux by inhibiting the ADRB2 signaling. Therefore, the combination of saikosaponin D and gemcitabine may be a potential therapeutic strategy for the treatment of iCCA. |
No. | Title | Href |
---|---|---|
1 | Combination of tanshinone IIA and doxorubicin possesses synergism and attenuation effects on doxorubicin in the treatment of breast cancer. Phytother Res. 2019 Jun;33(6):1658-1669. doi: 10.1002/ptr.6353. | Click |
2 | Quinacrine and Curcumin in combination decreased the breast cancer angiogenesis by modulating ABCG2 via VEGF A. J Cell Commun Signal. 2023 Sep;17(3):609-626. doi: 10.1007/s12079-022-00692-0. | Click |
3 | Carvacrol enhances anti-tumor activity and mitigates cardiotoxicity of sorafenib in thioacetamide-induced hepatocellular carcinoma model through inhibiting TRPM7. Life Sci. 2023 Jul 1;324:121735. doi: 10.1016/j.lfs.2023.121735. | Click |
4 | Camptothecin Sensitizes Hepatocellular Carcinoma Cells to Sorafenib- Induced Ferroptosis Via Suppression of Nrf2. Inflammation. 2023 Aug;46(4):1493-1511. doi: 10.1007/s10753-023-01823-4. | Click |
5 | Functional daidzein enhances the anticancer effect of topotecan and reverses BCRP-mediated drug resistance in breast cancer. Pharmacol Res. 2019 Sep;147:104387. doi: 10.1016/j.phrs.2019.104387. | Click |
6 | Ursolic acid inhibits proliferation and reverses drug resistance of ovarian cancer stem cells by downregulating ABCG2 through suppressing the expression of hypoxia-inducible factor-1α in vitro. Oncol Rep. 2016 Jul;36(1):428-40. doi: 10.3892/or.2016.4813. | Click |
7 | Curcumol Synergizes with Cisplatin in Osteosarcoma by Inhibiting M2-like Polarization of Tumor-Associated Macrophages. Molecules. 2022 Jul 6;27(14):4345. doi: 10.3390/molecules27144345. | Click |
8 | Thymoquinone chemosensitizes human colorectal cancer cells to imatinib via uptake/efflux genes modulation. Clin Exp Pharmacol Physiol. 2021 Jun;48(6):911-920. doi: 10.1111/1440-1681.13476. | Click |
9 | The carotenoid fucoxanthin can sensitize multidrug resistant cancer cells to doxorubicin via induction of apoptosis, inhibition of multidrug resistance proteins and metabolic enzymes. Phytomedicine. 2020 Oct;77:153280. doi: 10.1016/j.phymed.2020.153280. | Click |
10 | The effect of paclitaxel- and fisetin-loaded PBM nanoparticles on apoptosis and reversal of drug resistance gene ABCG2 in ovarian cancer. J Ovarian Res. 2023 Nov 21;16(1):220. doi: 10.1186/s13048-023-01308-w. | Click |
11 | Celastrol Inhibits the Proliferation and Decreases Drug Resistance of Cisplatin- Resistant Gastric Cancer SGC7901/DDP Cells. Anticancer Agents Med Chem. 2022;22(2):270-279. doi: 10.2174/1871520621666210528144006. | Click |
12 | Saikosaponin D reverses epinephrine- and norepinephrine-induced gemcitabine resistance in intrahepatic cholangiocarcinoma by downregulating ADRB2/glycolysis signaling. Acta Biochim Biophys Sin (Shanghai). 2023 Jul 25;55(9):1404-1414. doi: 10.3724/abbs.2023040. | Click |