
| Name | Proto-oncogene tyrosine-protein kinase Src | ||
| UniProt ID | SRC_HUMAN | ||
| Gene Name | SRC | ||
| Gene ID | 6714 | ||
| Synonyms |
SRC, ASV, SRC1, THC6, c-SRC, p60-Src
|
||
| Sequence |
MGSNKSKPKDASQRRRSLEPAENVHGAGGGAFPASQTPSKPASADGHRGPSAAFAPAAAE
PKLFGGFNSSDTVTSPQRAGPLAGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTEGD WWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESERLLLNAENPRGTFLVRES ETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGL CHRLTTVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTL KPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKGETGKY LRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEYT ARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVER GYRMPCPPECPESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQYQPGENL |
||
| Pathway Map | MAP LINK | ||
| T.C. Number | 8.A.23.1.12 | ||
| KEGG ID | hsa6714 | ||
| TTD ID | T85943 | ||
| Pfam | PF00017; PF00018; PF00069; PF03109; PF07653; PF07714; PF08239; PF12330; PF14604; PF17902 | ||
| Pair Name | Mahanine, Cisplatin | |||
| Phytochemical Name | Mahanine | |||
| Anticancer drug Name | Cisplatin | |||
| Disease Info | [ICD-11: 2C77.Z] | Cervical cancer | Investigative | |
| Regulate Info | Down-regulation | Proto-oncogene tyrosine-protein kinase Src | Phosphorylation | |
| Result | Our results revealed that mahanine may be a prospective agent to reduce the concentration of cisplatin in adjunct for the treatment of cancer and thereby decreasing its toxicity. | |||
| Pair Name | Oxymatrine, Paclitaxel | |||
| Phytochemical | Oxymatrine | |||
| Drug | Paclitaxel | |||
| Disease Info | [ICD-11: 2C25.Z] | Lung cancer | Investigative | |
| Regulate Info | Down-regulation | Proto-oncogene tyrosine-protein kinase Src | Phosphorylation | |
| Result | Oxymatrine Attenuates Tumor Growth and Deactivates STAT5 Signaling in a Lung Cancer Xenograft Model | |||
| Pair Name | Berbamine, Sorafenib | |||
| Phytochemical | Berbamine | |||
| Drug | Sorafenib | |||
| Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
| Regulate Info | Up-regulation | Proto-oncogene tyrosine-protein kinase Src | Phosphorylation | |
| Result | Targeting Na+/K+-ATPase by berbamine and ouabain synergizes with sorafenib to inhibit hepatocellular carcinoma | |||
| Pair Name | Kaempferol, Gefitinib | |||
| Phytochemical | Kaempferol | |||
| Drug | Gefitinib | |||
| Disease Info | [ICD-11: 2F7Z] | Glioma | Investigative | |
| Regulate Info | Down-regulation | Proto-oncogene tyrosine-protein kinase Src | Phosphorylation | |
| Result | Kaempferol suppresses glioma progression and synergistically enhances the antitumor activity of gefitinib by inhibiting the EGFR/SRC/STAT3 signaling pathway | |||
| Pair Name | Artesunate, Sorafenib | |||
| Phytochemical | Artesunate | |||
| Drug | Sorafenib | |||
| Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
| Regulate Info | Down-regulation | Proto-oncogene tyrosine-protein kinase Src | Phosphorylation | |
| Result | Artesunate may be a promising strategy to mitigate sorafenib resistance in HCC via exacerbating AFAP1L2-SRC-FUNDC1 axis-dependent mitophagy. | |||
| Pair Name | Furanodiene, Doxorubicin | |||
| Phytochemical | Furanodiene | |||
| Drug | Doxorubicin | |||
| Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
| Regulate Info | Down-regulation | Proto-oncogene tyrosine-protein kinase Src | Phosphorylation | |
| Result | These observations indicate that furanodiene is a potential agent that may be utilized to improve the anticancer efficacy of doxorubicin and overcome the risk of chemotherapy in highly metastatic breast cancer. | |||
| Pair Name | Decursin, Doxorubicin | |||
| Phytochemical | Decursin | |||
| Drug | Doxorubicin | |||
| Disease Info | [ICD-11: 2A83.1] | Multiple myeloma | Investigative | |
| Regulate Info | Down-regulation | Proto-oncogene tyrosine-protein kinase Src | Phosphorylation | |
| Result | The combination treatment of decursin and doxorubicin can enhance apoptotic activity via mTOR and/or STAT3 signaling pathway in multiple myeloma cells. | |||
| Pair Name | Erianin, Afatinib | |||
| Phytochemical | Erianin | |||
| Drug | Afatinib | |||
| Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
| Regulate Info | Down-regulation | Proto-oncogene tyrosine-protein kinase Src | Phosphorylation | |
| Result | EBTP/Afa targets VEGF and EGFR signaling pathways in liver cancer cells and tumor vasculature, thereby inhibiting the proliferation, motion and angiogenesis of liver cancer cells. Overall, this study provides a new combined strategy for the clinical treatment of hepatocellular carcinoma. | |||
| Pair Name | Sulforaphane, Metformin | |||
| Phytochemical | Sulforaphane | |||
| Drug | Metformin | |||
| Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
| Regulate Info | Down-regulation | Proto-oncogene tyrosine-protein kinase Src | Expression | |
| Result | Our data indicate that SLFN and MTFN can reduce cancer cell viability via both collaborative and differential effects and suggest that MTFN increases SLFN effectiveness by targeting common molecules/pathways downstream of HER2 and key for CSC signaling. | |||
| No. | Title | Href |
|---|---|---|
| 1 | Improved chemosensitivity in cervical cancer to cisplatin: synergistic activity of mahanine through STAT3 inhibition. Cancer Lett. 2014 Aug 28;351(1):81-90. doi: 10.1016/j.canlet.2014.05.005. | Click |
| 2 | Oxymatrine Attenuates Tumor Growth and Deactivates STAT5 Signaling in a Lung Cancer Xenograft Model. Cancers (Basel). 2019 Jan 7;11(1):49. doi: 10.3390/cancers11010049. | Click |
| 3 | Targeting Na+ /K+ -ATPase by berbamine and ouabain synergizes with sorafenib to inhibit hepatocellular carcinoma. Br J Pharmacol. 2021 Nov;178(21):4389-4407. doi: 10.1111/bph.15616. | Click |
| 4 | Kaempferol suppresses glioma progression and synergistically enhances the antitumor activity of gefitinib by inhibiting the EGFR/SRC/STAT3 signaling pathway. Drug Dev Res. 2023 May;84(3):592-610. doi: 10.1002/ddr.22048. | Click |
| 5 | Artesunate Sensitizes human hepatocellular carcinoma to sorafenib via exacerbating AFAP1L2-SRC-FUNDC1 axis-dependent mitophagy. Autophagy. 2023 Sep 21:1-16. doi: 10.1080/15548627.2023.2261758. | Click |
| 6 | Combined effects of furanodiene and doxorubicin on the migration and invasion of MDA-MB-231 breast cancer cells in vitro. Oncol Rep. 2017 Apr;37(4):2016-2024. doi: 10.3892/or.2017.5435. | Click |
| 7 | Decursin and Doxorubicin Are in Synergy for the Induction of Apoptosis via STAT3 and/or mTOR Pathways in Human Multiple Myeloma Cells. Evid Based Complement Alternat Med. 2013;2013:506324. doi: 10.1155/2013/506324. | Click |
| 8 | Ethoxy-erianin phosphate and afatinib synergistically inhibit liver tumor growth and angiogenesis via regulating VEGF and EGFR signaling pathways. Toxicol Appl Pharmacol. 2022 Mar 1;438:115911. doi: 10.1016/j.taap.2022.115911. | Click |
| 9 | Co-Treatment with Sulforaphane and Nano-Metformin Molecules Accelerates Apoptosis in HER2+ Breast Cancer Cells by Inhibiting Key Molecules. Nutr Cancer. 2020;72(5):835-848. doi: 10.1080/01635581.2019.1655073. | Click |