TOP
Nav Bar
  1. General Info
  2. Effects Info
  3. Reference
Molecular Details
01. General Information
Name Proto-oncogene tyrosine-protein kinase Src
UniProt ID SRC_HUMAN
Gene Name SRC
Gene ID 6714
Synonyms
SRC, ASV, SRC1, THC6, c-SRC, p60-Src
Sequence
MGSNKSKPKDASQRRRSLEPAENVHGAGGGAFPASQTPSKPASADGHRGPSAAFAPAAAE
PKLFGGFNSSDTVTSPQRAGPLAGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTEGD
WWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESERLLLNAENPRGTFLVRES
ETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGL
CHRLTTVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTL
KPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKGETGKY
LRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEYT
ARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVER
GYRMPCPPECPESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQYQPGENL
Pathway Map MAP LINK
T.C. Number 8.A.23.1.12
KEGG ID hsa6714
TTD ID T85943
Pfam PF00017; PF00018; PF00069; PF03109; PF07653; PF07714; PF08239; PF12330; PF14604; PF17902
02. Combinatorial Therapeutic Effect(s)
Synergistic Effect
Hide/Show
Decreasing Drug Toxicity
Hide/Show
Combination Pair ID: 508
Pair Name Mahanine, Cisplatin
Phytochemical Name Mahanine
Anticancer drug Name Cisplatin
Disease Info [ICD-11: 2C77.Z] Cervical cancer Investigative
Regulate Info Down-regulation Proto-oncogene tyrosine-protein kinase Src Phosphorylation
Result Our results revealed that mahanine may be a prospective agent to reduce the concentration of cisplatin in adjunct for the treatment of cancer and thereby decreasing its toxicity.
Enhancing Drug Efficacy
Hide/Show
Combination Pair ID: 18
Pair Name Oxymatrine, Paclitaxel
Phytochemical Oxymatrine
Drug Paclitaxel
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Down-regulation Proto-oncogene tyrosine-protein kinase Src Phosphorylation
Result Oxymatrine Attenuates Tumor Growth and Deactivates STAT5 Signaling in a Lung Cancer Xenograft Model
Combination Pair ID: 30
Pair Name Berbamine, Sorafenib
Phytochemical Berbamine
Drug Sorafenib
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Up-regulation Proto-oncogene tyrosine-protein kinase Src Phosphorylation
Result Targeting Na+/K+-ATPase by berbamine and ouabain synergizes with sorafenib to inhibit hepatocellular carcinoma
Combination Pair ID: 69
Pair Name Kaempferol, Gefitinib
Phytochemical Kaempferol
Drug Gefitinib
Disease Info [ICD-11: 2F7Z] Glioma Investigative
Regulate Info Down-regulation Proto-oncogene tyrosine-protein kinase Src Phosphorylation
Result Kaempferol suppresses glioma progression and synergistically enhances the antitumor activity of gefitinib by inhibiting the EGFR/SRC/STAT3 signaling pathway
Combination Pair ID: 1005
Pair Name Artesunate, Sorafenib
Phytochemical Artesunate
Drug Sorafenib
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Down-regulation Proto-oncogene tyrosine-protein kinase Src Phosphorylation
Result Artesunate may be a promising strategy to mitigate sorafenib resistance in HCC via exacerbating AFAP1L2-SRC-FUNDC1 axis-dependent mitophagy.
Combination Pair ID: 277
Pair Name Furanodiene, Doxorubicin
Phytochemical Furanodiene
Drug Doxorubicin
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Down-regulation Proto-oncogene tyrosine-protein kinase Src Phosphorylation
Result These observations indicate that furanodiene is a potential agent that may be utilized to improve the anticancer efficacy of doxorubicin and overcome the risk of chemotherapy in highly metastatic breast cancer.
Combination Pair ID: 335
Pair Name Decursin, Doxorubicin
Phytochemical Decursin
Drug Doxorubicin
Disease Info [ICD-11: 2A83.1] Multiple myeloma Investigative
Regulate Info Down-regulation Proto-oncogene tyrosine-protein kinase Src Phosphorylation
Result The combination treatment of decursin and doxorubicin can enhance apoptotic activity via mTOR and/or STAT3 signaling pathway in multiple myeloma cells.
Combination Pair ID: 427
Pair Name Erianin, Afatinib
Phytochemical Erianin
Drug Afatinib
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Down-regulation Proto-oncogene tyrosine-protein kinase Src Phosphorylation
Result EBTP/Afa targets VEGF and EGFR signaling pathways in liver cancer cells and tumor vasculature, thereby inhibiting the proliferation, motion and angiogenesis of liver cancer cells. Overall, this study provides a new combined strategy for the clinical treatment of hepatocellular carcinoma.
Combination Pair ID: 543
Pair Name Sulforaphane, Metformin
Phytochemical Sulforaphane
Drug Metformin
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Down-regulation Proto-oncogene tyrosine-protein kinase Src Expression
Result Our data indicate that SLFN and MTFN can reduce cancer cell viability via both collaborative and differential effects and suggest that MTFN increases SLFN effectiveness by targeting common molecules/pathways downstream of HER2 and key for CSC signaling.
03. Reference
No. Title Href
1 Improved chemosensitivity in cervical cancer to cisplatin: synergistic activity of mahanine through STAT3 inhibition. Cancer Lett. 2014 Aug 28;351(1):81-90. doi: 10.1016/j.canlet.2014.05.005. Click
2 Oxymatrine Attenuates Tumor Growth and Deactivates STAT5 Signaling in a Lung Cancer Xenograft Model. Cancers (Basel). 2019 Jan 7;11(1):49. doi: 10.3390/cancers11010049. Click
3 Targeting Na+ /K+ -ATPase by berbamine and ouabain synergizes with sorafenib to inhibit hepatocellular carcinoma. Br J Pharmacol. 2021 Nov;178(21):4389-4407. doi: 10.1111/bph.15616. Click
4 Kaempferol suppresses glioma progression and synergistically enhances the antitumor activity of gefitinib by inhibiting the EGFR/SRC/STAT3 signaling pathway. Drug Dev Res. 2023 May;84(3):592-610. doi: 10.1002/ddr.22048. Click
5 Artesunate Sensitizes human hepatocellular carcinoma to sorafenib via exacerbating AFAP1L2-SRC-FUNDC1 axis-dependent mitophagy. Autophagy. 2023 Sep 21:1-16. doi: 10.1080/15548627.2023.2261758. Click
6 Combined effects of furanodiene and doxorubicin on the migration and invasion of MDA-MB-231 breast cancer cells in vitro. Oncol Rep. 2017 Apr;37(4):2016-2024. doi: 10.3892/or.2017.5435. Click
7 Decursin and Doxorubicin Are in Synergy for the Induction of Apoptosis via STAT3 and/or mTOR Pathways in Human Multiple Myeloma Cells. Evid Based Complement Alternat Med. 2013;2013:506324. doi: 10.1155/2013/506324. Click
8 Ethoxy-erianin phosphate and afatinib synergistically inhibit liver tumor growth and angiogenesis via regulating VEGF and EGFR signaling pathways. Toxicol Appl Pharmacol. 2022 Mar 1;438:115911. doi: 10.1016/j.taap.2022.115911. Click
9 Co-Treatment with Sulforaphane and Nano-Metformin Molecules Accelerates Apoptosis in HER2+ Breast Cancer Cells by Inhibiting Key Molecules. Nutr Cancer. 2020;72(5):835-848. doi: 10.1080/01635581.2019.1655073. Click
It has been 458412 visits since 2024.08
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang
TOP