InterPAD - DETAILS

MAMQMQLEANADTSVEEESFGPQPISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKEL
INIKGISEAKADKILAEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETG
SITEMFGEFRTGKTQICHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGL
SGSDVLDNVAYARAFNTDHQTQLLYQASAMMVESRYALLIVDSATALYRTDYSGRGELSA
RQMHLARFLRMLLRLADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRL
YLRKGRGETRICKIYDSPCLPEAEAMFAINADGVGDAKD

No.	Title	Href
1	Selective synergistic anticancer effects of cisplatin and oridonin against human p53-mutant esophageal squamous carcinoma cells. Anticancer Drugs. 2022 Jan 1;33(1):e444-e452. doi: 10.1097/CAD.0000000000001237.	`Click`
2	Ginsenoside RG1 augments doxorubicin-induced apoptotic cell death in MDA-MB-231 breast cancer cell lines. J Biochem Mol Toxicol. 2022 Jan;36(1):e22945. doi: 10.1002/jbt.22945.	`Click`
3	Emodin interferes with AKT1-mediated DNA damage and decreases resistance of breast cancer cells to doxorubicin. Front Oncol. 2023 Dec 7;13:1337635. doi: 10.3389/fonc.2023.1337635.	`Click`
4	Berberine induces oxidative DNA damage and impairs homologous recombination repair in ovarian cancer cells to confer increased sensitivity to PARP inhibition. Cell Death Dis. 2017;8(10):e3070. Published 2017 Oct 5. doi:10.1038/cddis.2017.471	`Click`
5	Curcumin sensitizes carboplatin treatment in triple negative breast cancer through reactive oxygen species induced DNA repair pathway. Mol Biol Rep. 2022;49(4):3259-3270. doi:10.1007/s11033-022-07162-1.	`Click`
6	Curcumin enhances poly(ADP-ribose) polymerase inhibitor sensitivity to chemotherapy in breast cancer cells. J Nutr Biochem. 2015 Dec;26(12):1442-7. doi: 10.1016/j.jnutbio.2015.07.015.	`Click`
7	Corylin increases the sensitivity of hepatocellular carcinoma cells to chemotherapy through long noncoding RNA RAD51-AS1-mediated inhibition of DNA repair. Cell Death Dis. 2018 May 1;9(5):543. doi: 10.1038/s41419-018-0575-0.	`Click`
8	Falcarindiol Enhances Cisplatin Chemosensitivity of Hepatocellular Carcinoma via Down-Regulating the STAT3-Modulated PTTG1 Pathway. Front Pharmacol. 2021 May 7;12:656697. doi: 10.3389/fphar.2021.656697.	`Click`
9	Mitocurcumin utilizes oxidative stress to upregulate JNK/p38 signaling and overcomes Cytarabine resistance in acute myeloid leukemia. Cell Signal. 2024;114:111004. doi:10.1016/j.cellsig.2023.111004	`Click`

No.

Title

Href

Selective synergistic anticancer effects of cisplatin and oridonin against human p53-mutant esophageal squamous carcinoma cells. Anticancer Drugs. 2022 Jan 1;33(1):e444-e452. doi: 10.1097/CAD.0000000000001237.

Click

Ginsenoside RG1 augments doxorubicin-induced apoptotic cell death in MDA-MB-231 breast cancer cell lines. J Biochem Mol Toxicol. 2022 Jan;36(1):e22945. doi: 10.1002/jbt.22945.

Click

Emodin interferes with AKT1-mediated DNA damage and decreases resistance of breast cancer cells to doxorubicin. Front Oncol. 2023 Dec 7;13:1337635. doi: 10.3389/fonc.2023.1337635.

Click

Berberine induces oxidative DNA damage and impairs homologous recombination repair in ovarian cancer cells to confer increased sensitivity to PARP inhibition. Cell Death Dis. 2017;8(10):e3070. Published 2017 Oct 5. doi:10.1038/cddis.2017.471

Click

Curcumin sensitizes carboplatin treatment in triple negative breast cancer through reactive oxygen species induced DNA repair pathway. Mol Biol Rep. 2022;49(4):3259-3270. doi:10.1007/s11033-022-07162-1.

Click

Curcumin enhances poly(ADP-ribose) polymerase inhibitor sensitivity to chemotherapy in breast cancer cells. J Nutr Biochem. 2015 Dec;26(12):1442-7. doi: 10.1016/j.jnutbio.2015.07.015.

Click

Corylin increases the sensitivity of hepatocellular carcinoma cells to chemotherapy through long noncoding RNA RAD51-AS1-mediated inhibition of DNA repair. Cell Death Dis. 2018 May 1;9(5):543. doi: 10.1038/s41419-018-0575-0.

Click

Falcarindiol Enhances Cisplatin Chemosensitivity of Hepatocellular Carcinoma via Down-Regulating the STAT3-Modulated PTTG1 Pathway. Front Pharmacol. 2021 May 7;12:656697. doi: 10.3389/fphar.2021.656697.

Click

Mitocurcumin utilizes oxidative stress to upregulate JNK/p38 signaling and overcomes Cytarabine resistance in acute myeloid leukemia. Cell Signal. 2024;114:111004. doi:10.1016/j.cellsig.2023.111004

Click

Name	DNA repair protein RAD51 homolog 1
UniProt ID	RAD51_HUMAN
Gene Name	RAD51
Gene ID	5888
Synonyms	RAD51, BRCC5, FANCR, HRAD51, HsRad51, HsT16930, MRMV2, RAD51A, RECA
Sequence	MAMQMQLEANADTSVEEESFGPQPISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKEL INIKGISEAKADKILAEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETG SITEMFGEFRTGKTQICHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGL SGSDVLDNVAYARAFNTDHQTQLLYQASAMMVESRYALLIVDSATALYRTDYSGRGELSA RQMHLARFLRMLLRLADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRL YLRKGRGETRICKIYDSPCLPEAEAMFAINADGVGDAKD
Pathway Map	`MAP LINK`
KEGG ID	hsa5888
TTD ID	T63083
Pfam	PF00154; PF00633; PF00730; PF03796; PF06745; PF08423; PF13401; PF13481; PF14520; PF18272

Pair Name	Oridonin, Cisplatin
Phytochemical	Oridonin
Drug	Cisplatin
Disease Info	[ICD-11: 2B70]	Esophageal cancer	Investigative
Regulate Info	Down-regulation	DNA repair protein RAD51 homolog 1	Expression
Result	Selective synergistic anticancer effects of cisplatin and oridonin against human p53-mutant esophageal squamous carcinoma cells

Pair Name	Ginsenoside Rg1, Doxorubicin
Phytochemical	Ginsenoside Rg1
Drug	Doxorubicin
Disease Info	[ICD-11: 2C60]	Breast cancer	Investigative
Regulate Info	Up-regulation	DNA repair protein RAD51 homolog 1	Expression
Result	The present results support the chemosensitizing property of ginsenoside Rg1 in triple-negative breast cancer cell lines.

Pair Name	Emodin, Doxorubicin
Phytochemical	Emodin
Drug	Doxorubicin
Disease Info	[ICD-11: 2C60]	Breast cancer	Investigative
Regulate Info	Down-regulation	DNA repair protein RAD51 homolog 1	Expression
Result	Emodin Interferes With AKT1-Mediated DNA Damage and Decreases Resistance of Breast Cancer Cells to Doxorubicin

Pair Name	Berberine, Niraparib
Phytochemical	Berberine
Drug	Niraparib
Disease Info	[ICD-11: 2C73]	Ovarian cancer	Investigative
Regulate Info	Down-regulation	DNA repair protein RAD51 homolog 1	Expression
Result	The results indicate that by inducing oxidative DNA damage and downregulating HRR in cancer cells berberine is able to further sensitize cancer cells to PARP inhibition. These results demonstrate a potential therapeutic value of combined application of berberine and PARP inhibitors in ovarian cancer treatment.

Pair Name	Curcumin, Carboplatin
Phytochemical	Curcumin
Drug	Carboplatin
Disease Info	[ICD-11: 2C60]	Breast cancer	Investigative
Regulate Info	Down-regulation	DNA repair protein RAD51 homolog 1	Expression
Result	Our data demonstrate that curcumin sensitizes TNBC to the anticancer effect of carboplatin by increasing ROS-induced DNA damage, thus providing an effective combination treatment strategy for TNBC.

Pair Name	Curcumin, ABT-888
Phytochemical	Curcumin
Drug	ABT-888
Disease Info	[ICD-11:2B5Y]	Malignant mesenchymal neoplasm	Investigative
Regulate Info	Down-regulation	DNA repair protein RAD51 homolog 1	Expression
Result	Our study indicates that cotreatment of curcumin and PARP inhibitor might be useful for the combination chemotherapy for aggressive breast cancer treatment as a natural bioactive compound.

Pair Name	Corylin, Etoposide
Phytochemical	Corylin
Drug	Etoposide
Disease Info	[ICD-11: 2C12]	Hepatocellular carcinoma	Investigative
Regulate Info	Down-regulation	DNA repair protein RAD51 homolog 1	Expression
Result	Corylin increases the sensitivity of hepatocellular carcinoma cells to chemotherapy through long noncoding RNA RAD51-AS1-mediated inhibition of DNA repair

Pair Name	Falcarindiol, Cisplatin
Phytochemical	Falcarindiol
Drug	Cisplatin
Disease Info	[ICD-11: 2C12]	Hepatocellular carcinoma	Investigative
Regulate Info	Down-regulation	DNA repair protein RAD51 homolog 1	Expression
Result	Our study illustrated that FAD is a potential anticancer drug and strengthens the chemosensitivity of HCC cells to DDP by inhibiting the STAT3/PTTG1 pathway.

Pair Name	Mitocurcumin, Cytarabine
Phytochemical	Mitocurcumin
Drug	Cytarabine
Disease Info	[ICD-11: 2B33.4]	Leukemia	Investigative
Regulate Info	Down-regulation	DNA repair protein RAD51 homolog 1	Expression
Result	The data suggest that MitoC exploits stress-induced leukemic oxidative environment to up-regulate JNK/p38 signaling to lead to apoptosis and can potentially overcome Cytarabine resistance via ROS/p21/CHK1 axis.