TOP
Nav Bar
  1. General Info
  2. Effects Info
  3. Reference
Molecular Details
01. General Information
Name Proliferating cell nuclear antigen
UniProt ID PCNA_HUMAN
Gene Name PCNA
Gene ID 5111
Synonyms
PCNA, ATLD2
Sequence
MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTY
RCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMD
LDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNI
KLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYK
IADMGHLKYYLAPKIEDEEGS
Pathway Map MAP LINK
KEGG ID hsa5111
TTD ID T21782
Pfam PF00705; PF02144; PF02430; PF02663; PF02747; PF04005; PF04139
02. Combinatorial Therapeutic Effect(s)
Synergistic Effect
Hide/Show
Enhancing Drug Efficacy
Hide/Show
Combination Pair ID: 8
Pair Name Harmine, Paclitaxel
Phytochemical Harmine
Drug Paclitaxel
Disease Info [ICD-11: 2B72.Z] Gastric cancer Investigative
Regulate Info Down-regulation Proliferating cell nuclear antigen Expression
Result Harmine combined with paclitaxel inhibits tumor proliferation and induces apoptosis through down-regulation of cyclooxygenase-2 expression in gastric cancer
Combination Pair ID: 78
Pair Name Puerarin, Cisplatin
Phytochemical Puerarin
Drug Cisplatin
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Down-regulation Proliferating cell nuclear antigen Expression
Result Taking these results together, we can draw the conclusion that the PUE enhances the anti-tumor effect of DDP on the drug-resistant A549 cancer in vivo and in vitro through activation of the Wnt signaling pathway.
Combination Pair ID: 115
Pair Name Morusin, MAPK pathway inhibitors
Phytochemical Morusin
Drug MAPK pathway inhibitors
Disease Info [ICD-11: 2C30] Melanoma Investigative
Regulate Info Down-regulation Proliferating cell nuclear antigen Expression
Result Our results suggested that the combination of morusin and MAPK pathway inhibitors may be a more effective treatment strategy for BRAF-mutant melanoma than MAPK pathway inhibitors alone.
Combination Pair ID: 739
Pair Name Crocin, Sorafenib
Phytochemical Crocin
Drug Sorafenib
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Down-regulation Proliferating cell nuclear antigen Expression
Result CR potentiates the suppressive effects of SB on tumor growth and provides the opportunity to strengthen the therapeutic effects of SB in the treatment of HCC.
Combination Pair ID: 347
Pair Name Matairesinol, Fluorouracil
Phytochemical Matairesinol
Drug Fluorouracil
Disease Info [ICD-11: 2C10.Z] Pancreatic cancer Investigative
Regulate Info Down-regulation Proliferating cell nuclear antigen Expression
Result Matairesinol Induces Mitochondrial Dysfunction and Exerts Synergistic Anticancer Effects with 5-Fluorouracil in Pancreatic Cancer Cells
Combination Pair ID: 440
Pair Name alpha-Mangostin, Gemcitabine
Phytochemical alpha-Mangostin
Drug Gemcitabine
Disease Info [ICD-11: 2C13] Gallbladder cancer Investigative
Regulate Info Down-regulation Proliferating cell nuclear antigen Expression
Result α-Mangostin suppresses the de novo lipogenesis and enhances the chemotherapeutic response to gemcitabine in gallbladder carcinoma cells via targeting the AMPK/SREBP1 cascades.
Combination Pair ID: 557
Pair Name Lycopene, Enzalutamide
Phytochemical Lycopene
Drug Enzalutamide
Disease Info [ICD-11: 2C82.0] Prostate cancer Investigative
Regulate Info Down-regulation Proliferating cell nuclear antigen Expression
Result These results suggest that the enhanced antitumor effects of enzalutamide by lycopene may be related to the reduction of AR protein levels through lycopene-mediated inhibition of AKT/EZH2 pathway, which may provide a new approach to improve the efficacy of enzalutamide in CRPC.
03. Reference
No. Title Href
1 Harmine combined with paclitaxel inhibits tumor proliferation and induces apoptosis through down-regulation of cyclooxygenase-2 expression in gastric cancer. Oncol Lett. 2016 Aug;12(2):983-988. doi: 10.3892/ol.2016.4696. Click
2 Puerarin Enhances the Anti-Tumor Effect of Cisplatin on Drug-Resistant A549 Cancer in vivo and in vitro Through Activation of the Wnt Signaling Pathway. Cancer Manag Res. 2020 Jul 24;12:6279-6289. doi: 10.2147/CMAR.S253327. Click
3 Morusin enhances the antitumor activity of MAPK pathway inhibitors in BRAF-mutant melanoma by inhibiting the feedback activation of STAT3. Eur J Cancer. 2022 Apr;165:58-70. doi: 10.1016/j.ejca.2022.01.004. Click
4 Combining Crocin and Sorafenib Improves Their Tumor-Inhibiting Effects in a Rat Model of Diethylnitrosamine-Induced Cirrhotic-Hepatocellular Carcinoma. Cancers (Basel). 2023 Aug 11;15(16):4063. doi: 10.3390/cancers15164063. Click
5 Matairesinol Induces Mitochondrial Dysfunction and Exerts Synergistic Anticancer Effects with 5-Fluorouracil in Pancreatic Cancer Cells. Mar Drugs. 2022 Jul 25;20(8):473. doi: 10.3390/md20080473. Click
6 α-Mangostin suppresses the de novo lipogenesis and enhances the chemotherapeutic response to gemcitabine in gallbladder carcinoma cells via targeting the AMPK/SREBP1 cascades. J Cell Mol Med. 2020 Jan;24(1):760-771. doi: 10.1111/jcmm.14785. Click
7 Lycopene enhances the sensitivity of castration-resistant prostate cancer to enzalutamide through the AKT/EZH2/ androgen receptor signaling pathway. Biochem Biophys Res Commun. 2022 Jul 12;613:53-60. doi: 10.1016/j.bbrc.2022.04.126. Click
It has been 519087 visits since 2024.08
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang
TOP