TOP
Nav Bar
  1. General Info
  2. Effects Info
  3. Reference
Molecular Details
01. General Information
Name Fatty acid synthase
UniProt ID FAS_HUMAN
Gene Name FAS
Gene ID 355
Synonyms
FAS, ALPS1A, APO-1, APT1, CD95, FAS1, FASTM, TNFRSF6
Sequence
MLGIWTLLPLVLTSVARLSSKSVNAQVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCH
KPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCRLCDEGHGLEVEINCT
RTQNTKCRCKPNFFCNSTVCEHCDPCTKCEHGIIKECTLTSNTKCKEEGSRSNLGWLCLL
LLPIPLIVWVKRKEVQKTCRKHRKENQGSHESPTLNPETVAINLSDVDLSKYITTIAGVM
TLSQVKGFVRKNGVNEAKIDEIKNDNVQDTAEQKVQLLRNWHQLHGKKEAYDTLIKDLKK
ANLCTLAEKIQTIILKDITSDSENSNFRNEIQSLV
Pathway Map MAP LINK
T.C. Number 1.A.1.1.1; 1.A.1.10.19; 1.A.1.10.4; 1.A.1.10.5
KEGG ID hsa355
TTD ID T16514
Pfam PF00020; PF00531; PF03569; PF21733
02. Combinatorial Therapeutic Effect(s)
Synergistic Effect
Hide/Show
Decreasing Drug Toxicity
Hide/Show
Combination Pair ID: 80
Pair Name Rutin, Orlistat
Phytochemical Name Rutin
Anticancer drug Name Orlistat
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Down-regulation Fatty acid synthase Expression
Result Rutin and orlistat produce antitumor effects via antioxidant and apoptotic actions
Enhancing Drug Efficacy
Hide/Show
Combination Pair ID: 83
Pair Name Isoliquiritigenin, Docosahexaenoic acid
Phytochemical Isoliquiritigenin
Drug Docosahexaenoic acid
Disease Info [ICD-11: 2B91.Z] Colorectal cancer Investigative
Regulate Info Up-regulation Fatty acid synthase Expression
Result Excessive ROS-induced JNK activation and cytochrome c release from mitochondria played a key role in the synergistic anticancer activity of CRC cells by cotreating with DHA and ISL.
Combination Pair ID: 100
Pair Name Silibinin, Paclitaxel
Phytochemical Silibinin
Drug Paclitaxel
Disease Info [ICD-11: 2B72.Z] Gastric cancer Investigative
Regulate Info Up-regulation Fatty acid synthase Expression
Result Synergistic apoptotic effects of silibinin in enhancing paclitaxel toxicity in human gastric cancer cell lines
Combination Pair ID: 184
Pair Name Oridonin, Cetuximab
Phytochemical Oridonin
Drug Cetuximab
Disease Info [ICD-11: 2C23.Z] Laryngeal cancer Investigative
Regulate Info Down-regulation Fatty acid synthase Expression
Result Combined oridonin with cetuximab treatment shows synergistic anticancer effects on laryngeal squamous cell carcinoma: Involvement of inhibition of EGFR and activation of reactive oxygen species-mediated JNK pathway
Combination Pair ID: 284
Pair Name Shikonin, 4-hydroxytamoxifen
Phytochemical Shikonin
Drug 4-hydroxytamoxifen
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Fatty acid synthase Expression
Result The combination of SK and 4-OHT shows highly efficient anticancer effects on breast cancer therapy. SK may be a promising candidate as an adjuvant to 4-OHT for breast cancer treatments, especially for ER- breast cancer.
Combination Pair ID: 831
Pair Name Capsaicin, 3,3'-diindolylmethane
Phytochemical Capsaicin
Drug 3,3'-diindolylmethane
Disease Info [ICD-11: 2B90.Z] Colon cancer Investigative
Regulate Info Up-regulation Fatty acid synthase Expression
Result The present study suggests capsaicin and DIM work synergistically to inhibit cell proliferation and induce apoptosis in colorectal cancer through modulating transcriptional activity of NF-κB, p53, and target genes associated with apoptosis.
Combination Pair ID: 875
Pair Name Gossypol, Zoledronic acid
Phytochemical Gossypol
Drug Zoledronic acid
Disease Info [ICD-11: 2C82.0] Prostate cancer Investigative
Regulate Info Up-regulation Fatty acid synthase Expression
Result GP significantly enhances the anti-tumor activity of ZA in hormone- and drug-resistant prostate cancer cells by targeting many pivotal apoptosis-related proteins.
Combination Pair ID: 879
Pair Name Gambogic Acid, Cisplatin
Phytochemical Gambogic Acid
Drug Cisplatin
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation Fatty acid synthase Expression
Result Gambogic acid sensitises lung cancer cells to CDDP in vitro and in vivo in NSCLC through inactivation of NF-κB and MAPK/HO-1 signalling pathways, providing a rationale for the combined use of CDDP and GA in lung cancer chemotherapy.
Combination Pair ID: 886
Pair Name Gambogic Acid, Doxorubicin
Phytochemical Gambogic Acid
Drug Doxorubicin
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation Fatty acid synthase Expression
Result These findings indicate that GA sensitizes lung cancer cells to ADM in vitro and in vivo, providing a rationale for the combined use of GA and ADM in lung cancer chemotherapy.
Combination Pair ID: 912
Pair Name Lycopene, Eicosapentaenoic acid
Phytochemical Lycopene
Drug Eicosapentaenoic acid
Disease Info [ICD-11: 2B90.Z] Colon cancer Investigative
Regulate Info Up-regulation Fatty acid synthase Expression
Result Our novel findings suggest that lycopene and EPA synergistically inhibited the growth of human colon cancer HT-29 cells even at low concentration. The inhibitory effects of lycopene and EPA on cell proliferation of human colon cancer HT-29 cells were, in part, associated with the down-regulation of the PI-3K/Akt/mTOR signaling pathway.
Combination Pair ID: 949
Pair Name Phenethyl isothiocyanate, Irinotecan
Phytochemical Phenethyl isothiocyanate
Drug Irinotecan
Disease Info [ICD-11: 2B90.Z] Colon cancer Investigative
Regulate Info Up-regulation Fatty acid synthase Expression
Result PEITC potentiates IRI anticancer activity by promoting cell apoptosis in the human colon HCT 116 cells. Thus, PEITC may be a potential enhancer for IRI in humans as an anticolon cancer drug in the future.
Reversing Drug Resistance
Hide/Show
Combination Pair ID: 670
Pair Name Gambogic acid, Cisplatin
Phytochemical Gambogic acid
Drug Cisplatin
Disease Info [ICD-11: 2B51] Osteosarcoma Investigative
Regulate Info Up-regulation Fatty acid synthase Expression
Result Our results demonstrate that GA may be a new potent therapeutic agent useful for targeting human OS cells.
03. Reference
No. Title Href
1 Rutin and orlistat produce antitumor effects via antioxidant and apoptotic actions. Naunyn Schmiedebergs Arch Pharmacol. 2019 Feb;392(2):165-175. doi: 10.1007/s00210-018-1579-0. Click
2 Synergistic anticancer effect of docosahexaenoic acid and isoliquiritigenin on human colorectal cancer cells through ROS-mediated regulation of the JNK and cytochrome c release. Mol Biol Rep. 2021 Feb;48(2):1171-1180. doi: 10.1007/s11033-021-06159-6. Click
3 Synergistic apoptotic effects of silibinin in enhancing paclitaxel toxicity in human gastric cancer cell lines. Mol Med Rep. 2018 Aug;18(2):1835-1841. doi: 10.3892/mmr.2018.9129. Click
4 Combined oridonin with cetuximab treatment shows synergistic anticancer effects on laryngeal squamous cell carcinoma: involvement of inhibition of EGFR and activation of reactive oxygen species-mediated JNK pathway. Int J Oncol. 2016 Nov;49(5):2075-2087. doi: 10.3892/ijo.2016.3696. Click
5 Shikonin and 4-hydroxytamoxifen synergistically inhibit the proliferation of breast cancer cells through activating apoptosis signaling pathway in vitro and in vivo. Chin Med. 2020 Mar 10;15:23. doi: 10.1186/s13020-020-00305-1. Click
6 Synergistic anticancer activity of capsaicin and 3,3'-diindolylmethane in human colorectal cancer. J Agric Food Chem. 2015 May 6;63(17):4297-304. doi: 10.1021/jf506098s. Click
7 Targeting apoptosis in the hormone- and drug-resistant prostate cancer cell line, DU-145, by gossypol/zoledronic acid combination. Cell Biol Int. 2009 Nov;33(11):1165-72. doi: 10.1016/j.cellbi.2009.08.006. Click
8 Gambogic acid synergistically potentiates cisplatin-induced apoptosis in non-small-cell lung cancer through suppressing NF-κB and MAPK/HO-1 signalling. Br J Cancer. 2014 Jan 21;110(2):341-52. doi: 10.1038/bjc.2013.752. Click
9 Suppression of NF-κB signaling and P-glycoprotein function by gambogic acid synergistically potentiates adriamycin -induced apoptosis in lung cancer. Curr Cancer Drug Targets. 2014;14(1):91-103. doi: 10.2174/1568009613666131113100634. Click
10 Concomitant supplementation of lycopene and eicosapentaenoic acid inhibits the proliferation of human colon cancer cells. J Nutr Biochem. 2009 Jun;20(6):426-34. doi: 10.1016/j.jnutbio.2008.05.001. Click
11 Phenethyl isothiocyanate and irinotecan synergistically induce cell apoptosis in colon cancer HCT 116 cells in vitro. Environ Toxicol. 2024 Jan;39(1):457-469. doi: 10.1002/tox.23993. Click
12 Hypoxia-induced resistance to cisplatin-mediated apoptosis in osteosarcoma cells is reversed by gambogic acid independently of HIF-1α. Mol Cell Biochem. 2016 Sep;420(1-2):1-8. doi: 10.1007/s11010-016-2759-1. Click
It has been 419987 visits since 2024.08
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang
TOP