Name | Transforming growth factor beta-1 proprotein | ||
UniProt ID | TGFB1_HUMAN | ||
Gene Name | TGFB1 | ||
Gene ID | 7040 | ||
Synonyms |
TGFB1, CED, DPD1, IBDIMDE, LAP, TGF-beta1, TGFB, TGFbeta
|
||
Sequence |
MPPSGLRLLPLLLPLLWLLVLTPGRPAAGLSTCKTIDMELVKRKRIEAIRGQILSKLRLA
SPPSQGEVPPGPLPEAVLALYNSTRDRVAGESAEPEPEPEADYYAKEVTRVLMVETHNEI YDKFKQSTHSIYMFFNTSELREAVPEPVLLSRAELRLLRLKLKVEQHVELYQKYSNNSWR YLSNRLLAPSDSPEWLSFDVTGVVRQWLSRGGEIEGFRLSAHCSCDSRDNTLQVDINGFT TGRRGDLATIHGMNRPFLLLMATPLERAQHLQSSRHRRALDTNYCFSSTEKNCCVRQLYI DFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQA LEPLPIVYYVGRKPKVEQLSNMIVRSCKCS |
||
Pathway Map | MAP LINK | ||
T.C. Number | 9.B.87.1.37 | ||
KEGG ID | hsa7040 | ||
TTD ID | T97257 | ||
Pfam | PF00019; PF00688 |
Pair Name | Baicalein, Epirubicin | |||
Phytochemical Name | Baicalein | |||
Anticancer drug Name | Epirubicin | |||
Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
Regulate Info | Down-regulation | Transforming growth factor beta-1 proprotein | Expression | |
Result | BTME (200μg/mL) significantly enhanced epirubicin's cytotoxicity against Hep-G2 cells and ameliorated its safety profile. BTME could exert anti-hepatocarcinoma effect by enhancing apoptosis and autophagy |
Pair Name | Carvacrol, Sorafenib | |||
Phytochemical Name | Carvacrol | |||
Anticancer drug Name | Sorafenib | |||
Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
Regulate Info | Down-regulation | Transforming growth factor beta-1 proprotein | Expression | |
Result | CARV/Sora is a promising combination for tumor suppression and overcoming Sora resistance and cardiotoxicity in HCC by modulating TRPM7. To our best knowledge, this study represents the first study to investigate the efficiency of CARV/ Sora on the HCC rat model. Moreover, no previous studies have reported the effect of inhibiting TRPM7 on HCC. |
Pair Name | Usnic acid, Bleomycin | |||
Phytochemical Name | Usnic acid | |||
Anticancer drug Name | Bleomycin | |||
Disease Info | [ICD-11: 2F94] | Ascitic tumor | Investigative | |
Regulate Info | Up-regulation | Transforming growth factor beta-1 proprotein | Expression | |
Result | Effect-enhancing and toxicity-reducing activity of usnic acid in ascitic tumor-bearing mice treated with bleomycin |
Pair Name | Curcumin, Anti-PD-1 antibody | |||
Phytochemical | Curcumin | |||
Drug | Anti-PD-1 antibody | |||
Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
Regulate Info | Down-regulation | Transforming growth factor beta-1 proprotein | Expression | |
Result | Synergistic efficacy of curcumin and anti-programmed cell death-1 in hepatocellular carcinoma |
Pair Name | Paeoniflorin, Talatizidine | |||
Phytochemical | Paeoniflorin | |||
Drug | Talatizidine | |||
Disease Info | [ICD-11: FA20] | Rheumatoid arthritis | Investigative | |
Regulate Info | Down-regulation | Transforming growth factor beta-1 proprotein | Expression | |
Result | This study identified PAE and TLT as the main BACs of WTD in alleviating the severity of RA, and also developed a novel combination of PAE and TLT as a promising candidate drug for RA therapy. |
Pair Name | Quercetin, Anti-PD-1 antibody | |||
Phytochemical | Quercetin | |||
Drug | Anti-PD-1 antibody | |||
Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
Regulate Info | Up-regulation | Transforming growth factor beta-1 proprotein | Expression | |
Result | Quercetin/anti-PD-1 antibody combination therapy reshaped HCC tumor microenvironment in mice in parallel with regulating the GM and macrophage immunity. |
Pair Name | Thymoquinone, Fluorouracil | |||
Phytochemical | Thymoquinone | |||
Drug | Fluorouracil | |||
Disease Info | [ICD-11: 2A00-2F9Z] | Solid tumour or cancer | Investigative | |
Regulate Info | Up-regulation | Transforming growth factor beta-1 proprotein | Expression | |
Result | Our findings present the first report describing the in vivo enhancement effect of combined TQ and 5-FU against early stages of CRC; however, further studies are required to determine the value of this combination therapy in an advanced long-term model of CRC and also to realize its clinical potential. |
Pair Name | Thymoquinone, Gemcitabine | |||
Phytochemical | Thymoquinone | |||
Drug | Gemcitabine | |||
Disease Info | [ICD-11: 2C10] | Pancreatic cancer | Investigative | |
Regulate Info | Down-regulation | Transforming growth factor beta-1 proprotein | Expression | |
Result | TQ can promote apoptosis, inhibit migration, invasion, and metastasis, and enhance the sensitivity to GEM. The underlying mechanism may involve the regulation of ECM production through the TGFβ/Smad pathway, in which HIF-1α plays a key role. |
No. | Title | Href |
---|---|---|
1 | Chemotherapeutic effect of baicalein/epirubicin combination against liver cell carcinoma in-vitro: Inducing apoptosis and autophagy. Toxicol In Vitro. 2024 Mar;95:105744. doi: 10.1016/j.tiv.2023.105744. | Click |
2 | Carvacrol enhances anti-tumor activity and mitigates cardiotoxicity of sorafenib in thioacetamide-induced hepatocellular carcinoma model through inhibiting TRPM7. Life Sci. 2023 Jul 1;324:121735. doi: 10.1016/j.lfs.2023.121735. | Click |
3 | Effect-enhancing and toxicity-reducing activity of usnic acid in ascitic tumor-bearing mice treated with bleomycin. Int Immunopharmacol. 2017 May;46:146-155. doi: 10.1016/j.intimp.2017.03.004. | Click |
4 | Synergistic efficacy of curcumin and anti-programmed cell death-1 in hepatocellular carcinoma. Life Sci. 2021 Aug 15;279:119359. doi: 10.1016/j.lfs.2021.119359. | Click |
5 | Exploring and characterizing a novel combination of paeoniflorin and talatizidine for the treatment of rheumatoid arthritis. Pharmacol Res. 2020 Mar;153:104658. doi: 10.1016/j.phrs.2020.104658. | Click |
6 | Quercetin/Anti-PD-1 Antibody Combination Therapy Regulates the Gut Microbiota, Impacts Macrophage Immunity and Reshapes the Hepatocellular Carcinoma Tumor Microenvironment. Front Biosci (Landmark Ed). 2023 Dec 1;28(12):327. doi: 10.31083/j.fbl2812327. | Click |
7 | Thymoquinone subdues tumor growth and potentiates the chemopreventive effect of 5-fluorouracil on the early stages of colorectal carcinogenesis in rats. Drug Des Devel Ther. 2016 Jul 11;10:2239-53. doi: 10.2147/DDDT.S109721. | Click |
8 | Thymoquinone affects the gemcitabine sensitivity of pancreatic cancer by regulating collagen via hypoxia inducible factor-1α. Front Pharmacol. 2023 May 31;14:1138265. doi: 10.3389/fphar.2023.1138265. | Click |