TOP
Nav Bar
  1. General Info
  2. Effects Info
  3. Reference
Molecular Details
01. General Information
Name Transforming growth factor beta-1 proprotein
UniProt ID TGFB1_HUMAN
Gene Name TGFB1
Gene ID 7040
Synonyms
TGFB1, CED, DPD1, IBDIMDE, LAP, TGF-beta1, TGFB, TGFbeta
Sequence
MPPSGLRLLPLLLPLLWLLVLTPGRPAAGLSTCKTIDMELVKRKRIEAIRGQILSKLRLA
SPPSQGEVPPGPLPEAVLALYNSTRDRVAGESAEPEPEPEADYYAKEVTRVLMVETHNEI
YDKFKQSTHSIYMFFNTSELREAVPEPVLLSRAELRLLRLKLKVEQHVELYQKYSNNSWR
YLSNRLLAPSDSPEWLSFDVTGVVRQWLSRGGEIEGFRLSAHCSCDSRDNTLQVDINGFT
TGRRGDLATIHGMNRPFLLLMATPLERAQHLQSSRHRRALDTNYCFSSTEKNCCVRQLYI
DFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQA
LEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
Pathway Map MAP LINK
T.C. Number 9.B.87.1.37
KEGG ID hsa7040
TTD ID T97257
Pfam PF00019; PF00688
02. Combinatorial Therapeutic Effect(s)
Synergistic Effect
Hide/Show
Decreasing Drug Toxicity
Hide/Show
Combination Pair ID: 989
Pair Name Baicalein, Epirubicin
Phytochemical Name Baicalein
Anticancer drug Name Epirubicin
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Down-regulation Transforming growth factor beta-1 proprotein Expression
Result BTME (200μg/mL) significantly enhanced epirubicin's cytotoxicity against Hep-G2 cells and ameliorated its safety profile. BTME could exert anti-hepatocarcinoma effect by enhancing apoptosis and autophagy
Combination Pair ID: 429
Pair Name Carvacrol, Sorafenib
Phytochemical Name Carvacrol
Anticancer drug Name Sorafenib
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Down-regulation Transforming growth factor beta-1 proprotein Expression
Result CARV/Sora is a promising combination for tumor suppression and overcoming Sora resistance and cardiotoxicity in HCC by modulating TRPM7. To our best knowledge, this study represents the first study to investigate the efficiency of CARV/ Sora on the HCC rat model. Moreover, no previous studies have reported the effect of inhibiting TRPM7 on HCC.
Combination Pair ID: 503
Pair Name Usnic acid, Bleomycin
Phytochemical Name Usnic acid
Anticancer drug Name Bleomycin
Disease Info [ICD-11: 2F94] Ascitic tumor Investigative
Regulate Info Up-regulation Transforming growth factor beta-1 proprotein Expression
Result Effect-enhancing and toxicity-reducing activity of usnic acid in ascitic tumor-bearing mice treated with bleomycin
Enhancing Drug Efficacy
Hide/Show
Combination Pair ID: 393
Pair Name Curcumin, Anti-PD-1 antibody
Phytochemical Curcumin
Drug Anti-PD-1 antibody
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Down-regulation Transforming growth factor beta-1 proprotein Expression
Result Synergistic efficacy of curcumin and anti-programmed cell death-1 in hepatocellular carcinoma
Combination Pair ID: 214
Pair Name Paeoniflorin, Talatizidine
Phytochemical Paeoniflorin
Drug Talatizidine
Disease Info [ICD-11: FA20] Rheumatoid arthritis Investigative
Regulate Info Down-regulation Transforming growth factor beta-1 proprotein Expression
Result This study identified PAE and TLT as the main BACs of WTD in alleviating the severity of RA, and also developed a novel combination of PAE and TLT as a promising candidate drug for RA therapy.
Combination Pair ID: 975
Pair Name Quercetin, Anti-PD-1 antibody
Phytochemical Quercetin
Drug Anti-PD-1 antibody
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Up-regulation Transforming growth factor beta-1 proprotein Expression
Result Quercetin/anti-PD-1 antibody combination therapy reshaped HCC tumor microenvironment in mice in parallel with regulating the GM and macrophage immunity.
Combination Pair ID: 750
Pair Name Thymoquinone, Fluorouracil
Phytochemical Thymoquinone
Drug Fluorouracil
Disease Info [ICD-11: 2A00-2F9Z] Solid tumour or cancer Investigative
Regulate Info Up-regulation Transforming growth factor beta-1 proprotein Expression
Result Our findings present the first report describing the in vivo enhancement effect of combined TQ and 5-FU against early stages of CRC; however, further studies are required to determine the value of this combination therapy in an advanced long-term model of CRC and also to realize its clinical potential.
Combination Pair ID: 757
Pair Name Thymoquinone, Gemcitabine
Phytochemical Thymoquinone
Drug Gemcitabine
Disease Info [ICD-11: 2C10] Pancreatic cancer Investigative
Regulate Info Down-regulation Transforming growth factor beta-1 proprotein Expression
Result TQ can promote apoptosis, inhibit migration, invasion, and metastasis, and enhance the sensitivity to GEM. The underlying mechanism may involve the regulation of ECM production through the TGFβ/Smad pathway, in which HIF-1α plays a key role.
03. Reference
No. Title Href
1 Chemotherapeutic effect of baicalein/epirubicin combination against liver cell carcinoma in-vitro: Inducing apoptosis and autophagy. Toxicol In Vitro. 2024 Mar;95:105744. doi: 10.1016/j.tiv.2023.105744. Click
2 Carvacrol enhances anti-tumor activity and mitigates cardiotoxicity of sorafenib in thioacetamide-induced hepatocellular carcinoma model through inhibiting TRPM7. Life Sci. 2023 Jul 1;324:121735. doi: 10.1016/j.lfs.2023.121735. Click
3 Effect-enhancing and toxicity-reducing activity of usnic acid in ascitic tumor-bearing mice treated with bleomycin. Int Immunopharmacol. 2017 May;46:146-155. doi: 10.1016/j.intimp.2017.03.004. Click
4 Synergistic efficacy of curcumin and anti-programmed cell death-1 in hepatocellular carcinoma. Life Sci. 2021 Aug 15;279:119359. doi: 10.1016/j.lfs.2021.119359. Click
5 Exploring and characterizing a novel combination of paeoniflorin and talatizidine for the treatment of rheumatoid arthritis. Pharmacol Res. 2020 Mar;153:104658. doi: 10.1016/j.phrs.2020.104658. Click
6 Quercetin/Anti-PD-1 Antibody Combination Therapy Regulates the Gut Microbiota, Impacts Macrophage Immunity and Reshapes the Hepatocellular Carcinoma Tumor Microenvironment. Front Biosci (Landmark Ed). 2023 Dec 1;28(12):327. doi: 10.31083/j.fbl2812327. Click
7 Thymoquinone subdues tumor growth and potentiates the chemopreventive effect of 5-fluorouracil on the early stages of colorectal carcinogenesis in rats. Drug Des Devel Ther. 2016 Jul 11;10:2239-53. doi: 10.2147/DDDT.S109721. Click
8 Thymoquinone affects the gemcitabine sensitivity of pancreatic cancer by regulating collagen via hypoxia inducible factor-1α. Front Pharmacol. 2023 May 31;14:1138265. doi: 10.3389/fphar.2023.1138265. Click
It has been 47004 visits since 2024.08
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang
TOP