| Name | E3 ubiquitin-protein ligase Mdm2 | ||
| UniProt ID | MDM2_HUMAN | ||
| Gene Name | MDM2 | ||
| Gene ID | 4193 | ||
| Synonyms |
MDM2, ACTFS, HDMX, LSKB, hdm2
|
||
| Sequence |
MVRSRQMCNTNMSVPTDGAVTTSQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVL
FYLGQYIMTKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVVNQQE SSDSGTSVSENRCHLEGGSDQKDLVQELQEEKPSSSHLVSRPSTSSRRRAISETEENSDE LSGERQRKRHKSDSISLSFDESLALCVIREICCERSSSSESTGTPSNPDLDAGVSEHSGD WLDQDSVSDQFSVEFEVESLDSEDYSLSEEGQELSDEDDEVYQVTVYQAGESDTDSFEED PEISLADYWKCTSCNEMNPPLPSHCNRCWALRENWLPEDKGKDKGEISEKAKLENSTQAE EGFDVPDCKKTIVNDSRESCVEENDDKITQASQSQESEDYSQPSTSSSIIYSSQEDVKEF EREETQDKEESVESSLPLNAIEPCVICQGRPKNGCIVHGKTGHLMACFTCAKKLKKRNKP CPVCRQPIQMIVLTYFP |
||
| Pathway Map | MAP LINK | ||
| KEGG ID | hsa4193 | ||
| TTD ID | T00176 | ||
| Pfam | PF00641; PF02201; PF06827; PF13639; PF13920 | ||
| Pair Name | Acteoside, Thymic stromal lymphopoietin | |||
| Phytochemical Name | Acteoside | |||
| Anticancer drug Name | Thymic stromal lymphopoietin | |||
| Disease Info | [ICD-11: 2B33.4] | Leukemia | Investigative | |
| Regulate Info | Down-regulation | E3 ubiquitin-protein ligase Mdm2 | Expression | |
| Result | These results indicate that acteoside is a specific regulator of MDM2 activation in TSLP-stimulated mast cells, which indicates its potential use for the treatment of mast cell-mediated inflammatory diseases. | |||
| Pair Name | Mahanine, Fluorouracil | |||
| Phytochemical Name | Mahanine | |||
| Anticancer drug Name | Fluorouracil | |||
| Disease Info | [ICD-11: 2B90] | Colon cancer | Investigative | |
| Regulate Info | Down-regulation | E3 ubiquitin-protein ligase Mdm2 | Phosphorylation | |
| Result | Mahanine synergistically enhances cytotoxicity of 5-fluorouracil through ROS-mediated activation of PTEN and p53/p73 in colon carcinoma. | |||
| Pair Name | GingerenoneA, Dexamethasone | |||
| Phytochemical | GingerenoneA | |||
| Drug | Dexamethasone | |||
| Disease Info | [ICD-11: 2B33.3] | Acute lymphoblastic leukemia | Investigative | |
| Regulate Info | Up-regulation | E3 ubiquitin-protein ligase Mdm2 | Expression | |
| Result | Our findings may provide novel strategies for therapeutic intervention to ameliorate pALL outcomes. | |||
| Pair Name | Oridonin, Venetoclax | |||
| Phytochemical | Oridonin | |||
| Drug | Venetoclax | |||
| Disease Info | [ICD-11: 2A60.Z] | Acute myeloid leukemia | Investigative | |
| Regulate Info | Down-regulation | E3 ubiquitin-protein ligase Mdm2 | Expression | |
| Result | Oridonin and venetoclax synergistically promote AML cell apoptosis by inhibiting AKT signaling. | |||
| No. | Title | Href |
|---|---|---|
| 1 | Acteoside attenuates TSLP-induced mast cell proliferation via down-regulating MDM2. Int Immunopharmacol. 2015 May;26(1):23-9. doi: 10.1016/j.intimp.2015.03.003. | Click |
| 2 | Mahanine synergistically enhances cytotoxicity of 5-fluorouracil through ROS-mediated activation of PTEN and p53/p73 in colon carcinoma. Apoptosis. 2024 Feb 28. doi: 10.1007/s10495-024-01951-8. | Click |
| 3 | GingerenoneA overcomes dexamethasone resistance by activating apoptosis and inhibiting cell proliferation in pediatric T-ALL cells. Cancer Sci. 2023 Oct;114(10):3984-3995. doi: 10.1111/cas.15936 | Click |
| 4 | Oridonin Synergistically Enhances the Pro-Apoptotic Effect of Venetoclax on Acute Myeloid Leukemia Cells by Inhibiting AKT Signaling. Front Biosci (Landmark Ed). 2023 Sep 6;28(9):195. doi: 10.31083/j.fbl2809195. | Click |
