| Name | Prominin-1 | ||
| UniProt ID | PROM1_HUMAN | ||
| Gene Name | PROM1 | ||
| Gene ID | 8842 | ||
| Synonyms |
PROM1, AC133, CD133, CORD12, MCDR2, MSTP061, PROML1, RP41, STGD4
|
||
| Sequence |
MALVLGSLLLLGLCGNSFSGGQPSSTDAPKAWNYELPATNYETQDSHKAGPIGILFELVH
IFLYVVQPRDFPEDTLRKFLQKAYESKIDYDKPETVILGLKIVYYEAGIILCCVLGLLFI ILMPLVGYFFCMCRCCNKCGGEMHQRQKENGPFLRKCFAISLLVICIIISIGIFYGFVAN HQVRTRIKRSRKLADSNFKDLRTLLNETPEQIKYILAQYNTTKDKAFTDLNSINSVLGGG ILDRLRPNIIPVLDEIKSMATAIKETKEALENMNSTLKSLHQQSTQLSSSLTSVKTSLRS SLNDPLCLVHPSSETCNSIRLSLSQLNSNPELRQLPPVDAELDNVNNVLRTDLDGLVQQG YQSLNDIPDRVQRQTTTVVAGIKRVLNSIGSDIDNVTQRLPIQDILSAFSVYVNNTESYI HRNLPTLEEYDSYWWLGGLVICSLLTLIVIFYYLGLLCGVCGYDRHATPTTRGCVSNTGG VFLMVGVGLSFLFCWILMIIVVLTFVFGANVEKLICEPYTSKELFRVLDTPYLLNEDWEY YLSGKLFNKSKMKLTFEQVYSDCKKNRGTYGTLHLQNSFNISEHLNINEHTGSISSELES LKVNLNIFLLGAAGRKNLQDFAACGIDRMNYDSYLAQTGKSPAGVNLLSFAYDLEAKANS LPPGNLRNSLKRDAQTIKTIHQQRVLPIEQSLSTLYQSVKILQRTGNGLLERVTRILASL DFAQNFITNNTSSVIIEETKKYGRTIIGYFEHYLQWIEFSISEKVASCKPVATALDTAVD VFLCSYIIDPLNLFWFGIGKATVFLLPALIFAVKLAKYYRRMDSEDVYDDVETIPMKNME NGNNGYHKDHVYGIHNPVMTSPSQH |
||
| Pathway Map | MAP LINK | ||
| T.C. Number | 9.B.411.1.1 | ||
| KEGG ID | hsa8842 | ||
| TTD ID | T37434 | ||
| Pfam | PF02465; PF03836; PF04108; PF04513; PF04906; PF05478; PF06687; PF06749; PF07611; PF12725; PF16088; PF19827; PF20663 | ||
| Pair Name | Lupeol, Paclitaxel | |||
| Phytochemical Name | Lupeol | |||
| Anticancer drug Name | Paclitaxel | |||
| Disease Info | [ICD-11: 2B66.0] | Oral squamous cell carcinoma | Investigative | |
| Regulate Info | Down-regulation | Prominin-1 | Expression | |
| Result | Our findings elucidated mechanistic underpinning of hypoxia induced Laminin-5γ2 driven VM formation highlighting that Lupeol-Paclitaxel combination may serve as novel therapeutic intervention in perturbation of VM in human OSCC. | |||
| Pair Name | Berbamine, Arcyriaflavin A | |||
| Phytochemical | Berbamine | |||
| Drug | Arcyriaflavin A | |||
| Disease Info | [ICD-11: 2A00] | Glioblastoma multiforme | Investigative | |
| Regulate Info | Down-regulation | Prominin-1 | Expression | |
| Result | Our findings suggest that a novel combination therapy involving berbamine and ArcA could effectively eradicate glioblastoma stem-like cells. | |||
| Pair Name | Patchouli alcohol, Vincristine | |||
| Phytochemical | Patchouli alcohol | |||
| Drug | Vincristine | |||
| Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
| Regulate Info | Down-regulation | Prominin-1 | Expression | |
| Result | Patchouli alcohol induces G0 /G1 cell cycle arrest and apoptosis in vincristine-resistant non-small cell lung cancer through ROS-mediated DNA damage | |||
| Pair Name | Shikonin, BEZ235 | |||
| Phytochemical | Shikonin | |||
| Drug | BEZ235 | |||
| Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
| Regulate Info | Down-regulation | Prominin-1 | Expression | |
| Result | We found that low doses shikonin and dual PI3K-mTOR inhibitor (BEZ235) have a synergistic effect that inhibits the spheroid formation from chemoresistant lung cancer sublines. Inhibiting the proliferation of lung cancer stem cells is believed to reduce the recurrence of lung cancer; therefore, shikonin's anti-drug resistance and anti-cancer stem cell activities make it a highly interesting molecule for future combined lung cancer therapy. | |||
| Pair Name | Curcumin, Irinotecan | |||
| Phytochemical | Curcumin | |||
| Drug | Irinotecan | |||
| Disease Info | [ICD-11: 2B90] | Colon cancer | Investigative | |
| Regulate Info | Down-regulation | Prominin-1 | Expression | |
| Result | The present data demonstrated that curcumin attenuated resistance to chemotherapeutic drugs through induction of apoptosis of CSCs among colon cancer cells. These findings may provide novel evidence for the therapeutic application of curcumin in CRC intervention. | |||
| Pair Name | Sulforaphane, Gefitinib | |||
| Phytochemical | Sulforaphane | |||
| Drug | Gefitinib | |||
| Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
| Regulate Info | Down-regulation | Prominin-1 | Expression | |
| Result | The results of the present study demonstrated that SFN inhibits the proliferation of gefitinib-tolerant lung cancer cells via modulation of the SHH signaling pathway. Therefore, combined SFN and gefitinib therapy may be an effective approach for the treatment of lung cancer. | |||
| No. | Title | Href |
|---|---|---|
| 1 | Lupeol and Paclitaxel cooperate in hindering hypoxia induced vasculogenic mimicry via suppression of HIF-1α-EphA2-Laminin-5γ2 network in human oral cancer. J Cell Commun Signal. 2023 Sep;17(3):591-608. doi: 10.1007/s12079-022-00693-z. | Click |
| 2 | Synergistic Anticancer Effect of a Combination of Berbamine and Arcyriaflavin A against Glioblastoma Stem-like Cells. Molecules. 2022 Nov 17;27(22):7968. doi: 10.3390/molecules27227968. | Click |
| 3 | Patchouli alcohol induces G0 /G1 cell cycle arrest and apoptosis in vincristine-resistant non-small cell lung cancer through ROS-mediated DNA damage. Thorac Cancer. 2023 Jul;14(21):2007-2017. doi: 10.1111/1759-7714.14982. | Click |
| 4 | Attenuation of PI3K-Akt-mTOR Pathway to Reduce Cancer Stemness on Chemoresistant Lung Cancer Cells by Shikonin and Synergy with BEZ235 Inhibitor. Int J Mol Sci. 2024 Jan 3;25(1):616. doi: 10.3390/ijms25010616. | Click |
| 5 | Curcumin attenuates resistance to irinotecan via induction of apoptosis of cancer stem cells in chemoresistant colon cancer cells. Int J Oncol. 2018 Sep;53(3):1343-1353. doi: 10.3892/ijo.2018.4461. | Click |
| 6 | Sulforaphane reverses gefitinib tolerance in human lung cancer cells via modulation of sonic hedgehog signaling. Oncol Lett. 2018 Jan;15(1):109-114. doi: 10.3892/ol.2017.7293. | Click |
