TOP
Nav Bar
  1. General Info
  2. Effects Info
  3. Reference
Molecular Details
01. General Information
Name Vascular endothelial growth factor receptor 2
UniProt ID VGFR2_HUMAN
Gene Name KDR
Gene ID 3791
Synonyms
KDR, CD309, FLK1, VEGFR, VEGFR2
Sequence
MQSKVLLAVALWLCVETRAASVGLPSVSLDLPRLSIQKDILTIKANTTLQITCRGQRDLD
WLWPNNQSGSEQRVEVTECSDGLFCKTLTIPKVIGNDTGAYKCFYRETDLASVIYVYVQD
YRSPFIASVSDQHGVVYITENKNKTVVIPCLGSISNLNVSLCARYPEKRFVPDGNRISWD
SKKGFTIPSYMISYAGMVFCEAKINDESYQSIMYIVVVVGYRIYDVVLSPSHGIELSVGE
KLVLNCTARTELNVGIDFNWEYPSSKHQHKKLVNRDLKTQSGSEMKKFLSTLTIDGVTRS
DQGLYTCAASSGLMTKKNSTFVRVHEKPFVAFGSGMESLVEATVGERVRIPAKYLGYPPP
EIKWYKNGIPLESNHTIKAGHVLTIMEVSERDTGNYTVILTNPISKEKQSHVVSLVVYVP
PQIGEKSLISPVDSYQYGTTQTLTCTVYAIPPPHHIHWYWQLEEECANEPSQAVSVTNPY
PCEEWRSVEDFQGGNKIEVNKNQFALIEGKNKTVSTLVIQAANVSALYKCEAVNKVGRGE
RVISFHVTRGPEITLQPDMQPTEQESVSLWCTADRSTFENLTWYKLGPQPLPIHVGELPT
PVCKNLDTLWKLNATMFSNSTNDILIMELKNASLQDQGDYVCLAQDRKTKKRHCVVRQLT
VLERVAPTITGNLENQTTSIGESIEVSCTASGNPPPQIMWFKDNETLVEDSGIVLKDGNR
NLTIRRVRKEDEGLYTCQACSVLGCAKVEAFFIIEGAQEKTNLEIIILVGTAVIAMFFWL
LLVIILRTVKRANGGELKTGYLSIVMDPDELPLDEHCERLPYDASKWEFPRDRLKLGKPL
GRGAFGQVIEADAFGIDKTATCRTVAVKMLKEGATHSEHRALMSELKILIHIGHHLNVVN
LLGACTKPGGPLMVIVEFCKFGNLSTYLRSKRNEFVPYKTKGARFRQGKDYVGAIPVDLK
RRLDSITSSQSSASSGFVEEKSLSDVEEEEAPEDLYKDFLTLEHLICYSFQVAKGMEFLA
SRKCIHRDLAARNILLSEKNVVKICDFGLARDIYKDPDYVRKGDARLPLKWMAPETIFDR
VYTIQSDVWSFGVLLWEIFSLGASPYPGVKIDEEFCRRLKEGTRMRAPDYTTPEMYQTML
DCWHGEPSQRPTFSELVEHLGNLLQANAQQDGKDYIVLPISETLSMEEDSGLSLPTSPVS
CMEEEEVCDPKFHYDNTAGISQYLQNSKRKSRPVSVKTFEDIPLEEPEVKVIPDDNQTDS
GMVLASEELKTLEDRTKLSPSFGGMVPSKSRESVASEGSNQTSGYQSGYHSDDTDTTVYS
SEEAELLKLIEIGVQTGSTAQILQPDSGTTLSSPPV
Pathway Map MAP LINK
T.C. Number 1.A.1.10.16; 9.B.102.1.12
KEGG ID hsa3791
TTD ID T80975
Pfam PF00047; PF00069; PF07679; PF07686; PF07714; PF08205; PF10651; PF12330; PF13895; PF13927; PF16680; PF17988; PF21339
02. Combinatorial Therapeutic Effect(s)
Synergistic Effect
Hide/Show
Decreasing Drug Toxicity
Hide/Show
Combination Pair ID: 182
Pair Name Oridonin, Doxorubicin
Phytochemical Name Oridonin
Anticancer drug Name Doxorubicin
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Down-regulation Vascular endothelial growth factor receptor 2 Expression
Result Our findings provide strong evidence that Ori may be highly promising in enhancing the efficacy of Dox and decreasing its adverse cardiotoxic effects, thus suggesting that Ori may serve as a potential adjunct therapy during Dox-based chemotherapy.
Enhancing Drug Efficacy
Hide/Show
Combination Pair ID: 53
Pair Name Daurinoline, Sorafenib
Phytochemical Daurinoline
Drug Sorafenib
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Down-regulation Vascular endothelial growth factor receptor 2 Expression
Result Our study provides insights into the molecular mechanisms underlying DS-induced inhibition of VM, which may facilitate the development of a novel clinical anti-HCC drug. Moreover, our findings suggest that the combination of DS and sorafenib constitutes a potential therapeutic strategy for HCC.
Combination Pair ID: 215
Pair Name Ginsenoside Rb1, Apatinib
Phytochemical Ginsenoside Rb1
Drug Apatinib
Disease Info [ICD-11: 2B6E] Hypopharyngeal carcinoma Investigative
Regulate Info Down-regulation Vascular endothelial growth factor receptor 2 Expression
Result A combination of apatinib and G-Rb1 induced more tumor cell apoptosis and reduced cell proliferation than the individual drug treatment and promote antitumor immunity by enhancing immunomodulatory molecules. Thus, we believe that this study could serve as a valuable platform to assess the synergetic anticancer effects of the herbal as well as synthetic medicines.
Combination Pair ID: 427
Pair Name Erianin, Afatinib
Phytochemical Erianin
Drug Afatinib
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Down-regulation Vascular endothelial growth factor receptor 2 Phosphorylation
Result EBTP/Afa targets VEGF and EGFR signaling pathways in liver cancer cells and tumor vasculature, thereby inhibiting the proliferation, motion and angiogenesis of liver cancer cells. Overall, this study provides a new combined strategy for the clinical treatment of hepatocellular carcinoma.
Combination Pair ID: 433
Pair Name [6]-Gingerol, Cisplatin
Phytochemical [6]-Gingerol
Drug Cisplatin
Disease Info [ICD-11: 2C73] Ovarian cancer Investigative
Regulate Info Down-regulation Vascular endothelial growth factor receptor 2 Expression
Result The findings of the present study demonstrated that the cisplatin and 6-gingerol combination is more effective in inducing apoptosis and suppressing the angiogenesis of ovarian cancer cells than using each drug alone.
Combination Pair ID: 522
Pair Name Myriocin, Cisplatin
Phytochemical Myriocin
Drug Cisplatin
Disease Info [ICD-11: 2C30] Melanoma Investigative
Regulate Info Down-regulation Vascular endothelial growth factor receptor 2 Phosphorylation
Result We suggest that myriocin is a novel potent anti-cancer agent that dually targets both VEGFR2 in ECs and IκBα in cancer cells, and exerts more pronounced anti-tumor effects than with either kinase being inhibited alone.
Combination Pair ID: 918
Pair Name Zerumbone, Gefitinib
Phytochemical Zerumbone
Drug Gefitinib
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Down-regulation Vascular endothelial growth factor receptor 2 Expression
Result Our study suggested that zerumbone combined with gefitinib could effectively inhibit lung cancer for multi-model therapies, including the inhibition of tumor growth, angiogenesis, induce cell apoptosis, and ferroptosis.
03. Reference
No. Title Href
1 Oridonin synergistically enhances the anti-tumor efficacy of doxorubicin against aggressive breast cancer via pro-apoptotic and anti-angiogenic effects. Pharmacol Res. 2019 Aug;146:104313. doi: 10.1016/j.phrs.2019.104313. Click
2 The role of daurisoline treatment in hepatocellular carcinoma: Inhibiting vasculogenic mimicry formation and enhancing sensitivity to sorafenib. Phytomedicine. 2021 Nov;92:153740. doi: 10.1016/j.phymed.2021.153740. Click
3 Apatinib and Ginsenoside-Rb1 Synergetically Control the Growth of Hypopharyngeal Carcinoma Cells. Dis Markers. 2022 Jan 13;2022:3833489. doi: 10.1155/2022/3833489. Click
4 Ethoxy-erianin phosphate and afatinib synergistically inhibit liver tumor growth and angiogenesis via regulating VEGF and EGFR signaling pathways. Toxicol Appl Pharmacol. 2022 Mar 1;438:115911. doi: 10.1016/j.taap.2022.115911. Click
5 The inhibitory effect of 6-gingerol and cisplatin on ovarian cancer and antitumor activity: In silico, in vitro, and in vivo. Front Oncol. 2023 Mar 3;13:1098429. doi: 10.3389/fonc.2023.1098429. Click
6 Dual anti-angiogenic and anti-metastatic activity of myriocin synergistically enhances the anti-tumor activity of cisplatin. Cell Oncol (Dordr). 2023 Feb;46(1):117-132. doi: 10.1007/s13402-022-00737-x. Click
7 Zerumbone combined with gefitinib alleviates lung cancer cell growth through the AKT/STAT3/SLC7A11 axis. Neoplasma. 2023 Feb;70(1):58-70. doi: 10.4149/neo_2022_220418N423. Click
It has been 590039 visits since 2024.08
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang
TOP