Name | Tyrosine-protein kinase JAK2 | ||
UniProt ID | JAK2_HUMAN | ||
Gene Name | JAK2 | ||
Gene ID | 3717 | ||
Synonyms |
JAK2, JTK10
|
||
Sequence |
MGMACLTMTEMEGTSTSSIYQNGDISGNANSMKQIDPVLQVYLYHSLGKSEADYLTFPSG
EYVAEEICIAASKACGITPVYHNMFALMSETERIWYPPNHVFHIDESTRHNVLYRIRFYF PRWYCSGSNRAYRHGISRGAEAPLLDDFVMSYLFAQWRHDFVHGWIKVPVTHETQEECLG MAVLDMMRIAKENDQTPLAIYNSISYKTFLPKCIRAKIQDYHILTRKRIRYRFRRFIQQF SQCKATARNLKLKYLINLETLQSAFYTEKFEVKEPGSGPSGEEIFATIIITGNGGIQWSR GKHKESETLTEQDLQLYCDFPNIIDVSIKQANQEGSNESRVVTIHKQDGKNLEIELSSLR EALSFVSLIDGYYRLTADAHHYLCKEVAPPAVLENIQSNCHGPISMDFAISKLKKAGNQT GLYVLRCSPKDFNKYFLTFAVERENVIEYKHCLITKNENEEYNLSGTKKNFSSLKDLLNC YQMETVRSDNIIFQFTKCCPPKPKDKSNLLVFRTNGVSDVPTSPTLQRPTHMNQMVFHKI RNEDLIFNESLGQGTFTKIFKGVRREVGDYGQLHETEVLLKVLDKAHRNYSESFFEAASM MSKLSHKHLVLNYGVCVCGDENILVQEFVKFGSLDTYLKKNKNCINILWKLEVAKQLAWA MHFLEENTLIHGNVCAKNILLIREEDRKTGNPPFIKLSDPGISITVLPKDILQERIPWVP PECIENPKNLNLATDKWSFGTTLWEICSGGDKPLSALDSQRKLQFYEDRHQLPAPKWAEL ANLINNCMDYEPDFRPSFRAIIRDLNSLFTPDYELLTENDMLPNMRIGALGFSGAFEDRD PTQFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIE ILKSLQHDNIVKYKGVCYSAGRRNLKLIMEYLPYGSLRDYLQKHKERIDHIKLLQYTSQI CKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEYYKVKEPGESPIFW YAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIE LLKNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRDLALRVDQIRDNMAG |
||
Pathway Map | MAP LINK | ||
T.C. Number | 8.A.152.1.12 | ||
KEGG ID | hsa3717 | ||
TTD ID | T08391 | ||
Pfam | PF00017; PF00069; PF00373; PF01163; PF03109; PF07714; PF14531; PF17887; PF18377; PF18379; PF21477 |
Pair Name | Astaxanthin, Sorafenib | |||
Phytochemical | Astaxanthin | |||
Drug | Sorafenib | |||
Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
Regulate Info | Down-regulation | Tyrosine-protein kinase JAK2 | Phosphorylation | |
Result | Astaxanthin Augmented the Anti-Hepatocellular Carcinoma Efficacy of Sorafenib Through the Inhibition of the JAK2/STAT3 Signaling Pathway and Mitigation of Hypoxia within the Tumor Microenvironment |
Pair Name | Beta-Elemene, Cisplatin | |||
Phytochemical | Beta-Elemene | |||
Drug | Cisplatin | |||
Disease Info | [ICD-11: 2B63] | Gingival squamous cell carcinoma | Investigative | |
Regulate Info | Down-regulation | Tyrosine-protein kinase JAK2 | Phosphorylation | |
Result | The results indicated that β-elemene promoted the anti-proliferative and apoptotic effect of cisplatin by inhibiting STAT3 and blocking the JAK2-STAT3 signaling pathway in GSCC in vitro and in vivo. |
Pair Name | Cryptotanshinone, Trifluridine | |||
Phytochemical | Cryptotanshinone | |||
Drug | Trifluridine | |||
Disease Info | [ICD-11: 2B72] | Gastric cancer | Investigative | |
Regulate Info | Down-regulation | Tyrosine-protein kinase JAK2 | Phosphorylation | |
Result | FTD combined with CTS has a synergistic anti-gastric cancer effect as shown by in vitro and in vivo experiments, and the combined treatment of FTD and CTS will be a promising treatment option for advanced gastric cancer. |
Pair Name | Curcumin, Arsenic trioxide | |||
Phytochemical | Curcumin | |||
Drug | Arsenic trioxide | |||
Disease Info | [ICD-11: 2A60.Z] | Acute myeloid leukemia | Investigative | |
Regulate Info | Down-regulation | Tyrosine-protein kinase JAK2 | Expression | |
Result | Our results suggested that curcumin and As2O3 combination therapy exerts more significant anti-leukemia effects in the treatment of AML than curcumin or As2O3 monotherapy by up-regulating p53 pathway and down-regulating the JAK2/STAT3 pathway. |
Pair Name | Decursin, Doxorubicin | |||
Phytochemical | Decursin | |||
Drug | Doxorubicin | |||
Disease Info | [ICD-11: 2A83] | Multiple myeloma | Investigative | |
Regulate Info | Down-regulation | Tyrosine-protein kinase JAK2 | Phosphorylation | |
Result | The combination treatment of decursin and doxorubicin can enhance apoptotic activity via mTOR and/or STAT3 signaling pathway in multiple myeloma cells. |
Pair Name | Lycopene, Anti-PD-1 antibody | |||
Phytochemical | Lycopene | |||
Drug | Anti-PD-1 antibody | |||
Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
Regulate Info | Up-regulation | Tyrosine-protein kinase JAK2 | Phosphorylation | |
Result | lycopene promoted anti-PD-1 therapeutic efficiency of lung cancer by promoting IFNγ-expressing CD8+ cells infiltrated in tumor tissues and increasing IFNγ expression in tumor cells. |
Pair Name | Oxymatrine, Paclitaxel | |||
Phytochemical | Oxymatrine | |||
Drug | Paclitaxel | |||
Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
Regulate Info | Down-regulation | Tyrosine-protein kinase JAK2 | Phosphorylation | |
Result | Oxymatrine Attenuates Tumor Growth and Deactivates STAT5 Signaling in a Lung Cancer Xenograft Model |
Pair Name | Sanguinarium, Bortezomib | |||
Phytochemical | Sanguinarium | |||
Drug | Bortezomib | |||
Disease Info | [ICD-11: 2A83] | Multiple myeloma | Investigative | |
Regulate Info | Down-regulation | Tyrosine-protein kinase JAK2 | Expression | |
Result | Our findings demonstrate that SNG induces mitochondrial and caspase-dependent apoptosis, generates oxidative stress, and suppresses MM cell lines proliferation. In addition, co-treatment of MM cell lines with sub-toxic doses of SNG and BTZ potentiated the cytotoxic activity. These results would suggest that SNG could be developed into therapeutic agent either alone or in combination with other anticancer drugs in MM. |
Pair Name | Tanshinone IIA, Anti-mouse PD-1 | |||
Phytochemical | Tanshinone IIA | |||
Drug | Anti-mouse PD-1 | |||
Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
Regulate Info | Down-regulation | Tyrosine-protein kinase JAK2 | Expression | |
Result | This study reveals a new mechanism between TSA and ELTD1 for vascular normalization, suggesting that therapeutic or pharmacological intervention with ELTD1 may enhance the efficacy of PD-1 inhibitors in HCC. |
Pair Name | Zerumbone, Cisplatin | |||
Phytochemical | Zerumbone | |||
Drug | Cisplatin | |||
Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
Regulate Info | Down-regulation | Tyrosine-protein kinase JAK2 | Expression | |
Result | The current study indicates that the treatment of 4.62 μM of ZER combined with 1.93 μM of CIS in human liver cancer cells exerts synergistic effects on cell growth inhibition, apoptosis induction, angiogenesis, and invasion by modulating gene expression. |
No. | Title | Href |
---|---|---|
1 | Astaxanthin Augmented the Anti-Hepatocellular Carcinoma Efficacy of Sorafenib Through the Inhibition of the JAK2/STAT3 Signaling Pathway and Mitigation of Hypoxia within the Tumor Microenvironment. Mol Nutr Food Res. 2024 Jan;68(2):e2300569. doi: 10.1002/mnfr.202300569. | Click |
2 | Synergistic Cytotoxicity of β-Elemene and Cisplatin in Gingival Squamous Cell Carcinoma by Inhibition of STAT3 Signaling Pathway. Med Sci Monit. 2017 Mar 29;23:1507-1513. doi: 10.12659/msm.903783. | Click |
3 | Effects and mechanisms of trifluridine alone or in combination with cryptotanshinone in inhibiting malignant biological behavior of gastric cancer. Cell Cycle. 2023 Jun;22(12):1463-1477. doi: 10.1080/15384101.2023.2215678. | Click |
4 | Curcumin combined with arsenic trioxide in the treatment of acute myeloid leukemia: network pharmacology analysis and experimental validation. J Cancer Res Clin Oncol. 2023 Jan;149(1):219-230. doi: 10.1007/s00432-022-04463-7. | Click |
5 | Decursin and Doxorubicin Are in Synergy for the Induction of Apoptosis via STAT3 and/or mTOR Pathways in Human Multiple Myeloma Cells. Evid Based Complement Alternat Med. 2013;2013:506324. doi: 10.1155/2013/506324. | Click |
6 | Lycopene improves the efficiency of anti-PD-1 therapy via activating IFN signaling of lung cancer cells. Cancer Cell Int. 2019 Mar 21;19:68. doi: 10.1186/s12935-019-0789-y. | Click |
7 | Oxymatrine Attenuates Tumor Growth and Deactivates STAT5 Signaling in a Lung Cancer Xenograft Model. Cancers (Basel). 2019 Jan 7;11(1):49. doi: 10.3390/cancers11010049. | Click |
8 | Sanguinarine Induces Apoptosis Pathway in Multiple Myeloma Cell Lines via Inhibition of the JaK2/STAT3 Signaling. Front Oncol. 2019 Apr 17;9:285. doi: 10.3389/fonc.2019.00285. | Click |
9 | Tanshinone IIA normalized hepatocellular carcinoma vessels and enhanced PD-1 inhibitor efficacy by inhibiting ELTD1. Phytomedicine. 2024 Jan;123:155191. doi: 10.1016/j.phymed.2023.155191. | Click |
10 | Zerumbone Sensitizes the Anti-Cancer Efficacy of Cisplatin in Hepatocellular Carcinoma Cells. Anticancer Agents Med Chem. 2022 Aug 4;22(16):2885-2895. doi: 10.2174/1871520622666220324090801. | Click |