TOP
Nav Bar
  1. General Info
  2. Effects Info
  3. Reference
Molecular Details
01. General Information
Name Inhibitor of nuclear factor kappa-B kinase subunit epsilon
UniProt ID IKKE_HUMAN
Gene Name IKBKE
Gene ID 9641
Synonyms
IKBKE, IKK-E, IKK-i, IKKE, IKKI
Sequence
MQSTANYLWHTDDLLGQGATASVYKARNKKSGELVAVKVFNTTSYLRPREVQVREFEVLR
KLNHQNIVKLFAVEETGGSRQKVLVMEYCSSGSLLSVLESPENAFGLPEDEFLVVLRCVV
AGMNHLRENGIVHRDIKPGNIMRLVGEEGQSIYKLTDFGAARELDDDEKFVSVYGTEEYL
HPDMYERAVLRKPQQKAFGVTVDLWSIGVTLYHAATGSLPFIPFGGPRRNKEIMYRITTE
KPAGAIAGAQRRENGPLEWSYTLPITCQLSLGLQSQLVPILANILEVEQAKCWGFDQFFA
ETSDILQRVVVHVFSLSQAVLHHIYIHAHNTIAIFQEAVHKQTSVAPRHQEYLFEGHLCV
LEPSVSAQHIAHTTASSPLTLFSTAIPKGLAFRDPALDVPKFVPKVDLQADYNTAKGVLG
AGYQALRLARALLDGQELMFRGLHWVMEVLQATCRRTLEVARTSLLYLSSSLGTERFSSV
AGTPEIQELKAAAELRSRLRTLAEVLSRCSQNITETQESLSSLNRELVKSRDQVHEDRSI
QQIQCCLDKMNFIYKQFKKSRMRPGLGYNEEQIHKLDKVNFSHLAKRLLQVFQEECVQKY
QASLVTHGKRMRVVHETRNHLRLVGCSVAACNTEAQGVQESLSKLLEELSHQLLQDRAKG
AQASPPPIAPYPSPTRKDLLLHMQELCEGMKLLASDLLDNNRIIERLNRVPAPPDV
Pathway Map MAP LINK
KEGG ID hsa9641
Pfam PF00069; PF03109; PF07714; PF13901; PF14531; PF18394; PF18396; PF19111
02. Combinatorial Therapeutic Effect(s)
Synergistic Effect
Hide/Show
Enhancing Drug Efficacy
Hide/Show
Combination Pair ID: 47
Pair Name Dihydroberberine, Sunitinib
Phytochemical Dihydroberberine
Drug Sunitinib
Disease Info [ICD-11: 2C25] Lung cancer Investigative
Regulate Info Down-regulation Inhibitor of nuclear factor kappa-B kinase subunit epsilon Expression
Result DCS induced the expression of cell cycle signal molecules that are known to be affected by JNK and p38. The change of cell cycle, in turn, led to down-regulation of JNK and p38, and further reduced IL-1 secretion. Collectively, these findings highlight potential molecular mechanisms of DCS chemotherapeutic activity and suggest that DCS is an efficacious strategy in NSCLC therapy.
Combination Pair ID: 24
Pair Name Lycorine, Temozolomide
Phytochemical Lycorine
Drug Temozolomide
Disease Info [ICD-11: 2A00] Glioblastoma multiforme Investigative
Regulate Info Up-regulation Inhibitor of nuclear factor kappa-B kinase subunit epsilon Expression
Result Our study suggested that lycorine exerts an anti-glioma effect by inducing ROS production and inhibiting NF-κB, which validated that lycorine may be a potential candidate for glioma treatment alone or in combination with TMZ.
Combination Pair ID: 482
Pair Name Propyl gallate, Temozolomide
Phytochemical Propyl gallate
Drug Temozolomide
Disease Info [ICD-11: 2A00] Glioblastoma multiforme Investigative
Regulate Info Down-regulation Inhibitor of nuclear factor kappa-B kinase subunit epsilon Phosphorylation
Result Propyl Gallate Exerts an Antimigration Effect on Temozolomide-Treated Malignant Glioma Cells through Inhibition of ROS and the NF- κ B Pathway
Combination Pair ID: 480
Pair Name Tectochrysin, Cetuximab
Phytochemical Tectochrysin
Drug Cetuximab
Disease Info [ICD-11: 2B90] Colon cancer Investigative
Regulate Info Down-regulation Inhibitor of nuclear factor kappa-B kinase subunit epsilon Phosphorylation
Result Our results indicate that combined therapy with lower concentration of cetuximab and tectochrysin could significantly enhance the cancer cell growth inhibitory effect through the inhibition of EGFR signaling.
Combination Pair ID: 136
Pair Name Tectorigenin, Paclitaxel
Phytochemical Tectorigenin
Drug Paclitaxel
Disease Info [ICD-11: 2C73] Ovarian cancer Investigative
Regulate Info Down-regulation Inhibitor of nuclear factor kappa-B kinase subunit epsilon Phosphorylation
Result These data suggest that tectorigenin could sensitize paclitaxel-resistant human ovarian cancer cells through inactivation of the Akt/IKK/IκB/NFκB signaling pathway, and promise a new intervention to chemosensitize paclitaxel-induced cytotoxicity in ovarian cancer.
03. Reference
No. Title Href
1 Dihydroberberine exhibits synergistic effects with sunitinib on NSCLC NCI-H460 cells by repressing MAP kinase pathways and inflammatory mediators. J Cell Mol Med. 2017 Oct;21(10):2573-2585. doi: 10.1111/jcmm.13178. Click
2 Induction of apoptosis in glioma cells by lycorine via reactive oxygen species generation and regulation of NF-κB pathways. Naunyn Schmiedebergs Arch Pharmacol. 2023 Jun;396(6):1247-1255. doi: 10.1007/s00210-023-02384-x. Click
3 Propyl Gallate Exerts an Antimigration Effect on Temozolomide-Treated Malignant Glioma Cells through Inhibition of ROS and the NF-κB Pathway. J Immunol Res. 2017;2017:9489383. doi: 10.1155/2017/9489383. Click
4 Synergistic inhibitory effect of cetuximab and tectochrysin on human colon cancer cell growth via inhibition of EGFR signal. Arch Pharm Res. 2016 May;39(5):721-9. doi: 10.1007/s12272-016-0735-7. Click
5 Tectorigenin sensitizes paclitaxel-resistant human ovarian cancer cells through downregulation of the Akt and NFκB pathway. Carcinogenesis. 2012 Dec;33(12):2488-98. doi: 10.1093/carcin/bgs302. Click
It has been 47598 visits since 2024.08
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang
TOP