TOP
Nav Bar
  1. General Info
  2. Effects Info
  3. Reference
Molecular Details
01. General Information
Name Glutathione synthetase
UniProt ID GSHB_HUMAN
Gene Name GSS
Gene ID 2937
Synonyms
GSS, GSHS, HEL-S-64p, HEL-S-88n
Sequence
MATNWGSLLQDKQQLEELARQAVDRALAEGVLLRTSQEPTSSEVVSYAPFTLFPSLVPSA
LLEQAYAVQMDFNLLVDAVSQNAAFLEQTLSSTIKQDDFTARLFDIHKQVLKEGIAQTVF
LGLNRSDYMFQRSADGSPALKQIEINTISASFGGLASRTPAVHRHVLSVLSKTKEAGKIL
SNNPSKGLALGIAKAWELYGSPNALVLLIAQEKERNIFDQRAIENELLARNIHVIRRTFE
DISEKGSLDQDRRLFVDGQEIAVVYFRDGYMPRQYSLQNWEARLLLERSHAAKCPDIATQ
LAGTKKVQQELSRPGMLEMLLPGQPEAVARLRATFAGLYSLDVGEEGDQAIAEALAAPSR
FVLKPQREGGGNNLYGEEMVQALKQLKDSEERASYILMEKIEPEPFENCLLRPGSPARVV
QCISELGIFGVYVRQEKTLVMNKHVGHLLRTKAIEHADGGVAAGVAVLDNPYPV
Pathway Map MAP LINK
T.C. Number 2.A.16.5.2; 3.A.1.208.8; 3.A.1.5.27
KEGG ID hsa2937
TTD ID T69420
Pfam PF03199; PF03917
02. Combinatorial Therapeutic Effect(s)
Synergistic Effect
Hide/Show
Decreasing Drug Toxicity
Hide/Show
Combination Pair ID: 80
Pair Name Rutin, Orlistat
Phytochemical Name Rutin
Anticancer drug Name Orlistat
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Glutathione synthetase Expression
Result Rutin and orlistat produce antitumor effects via antioxidant and apoptotic actions
Combination Pair ID: 429
Pair Name Carvacrol, Sorafenib
Phytochemical Name Carvacrol
Anticancer drug Name Sorafenib
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Up-regulation Glutathione synthetase Expression
Result CARV/Sora is a promising combination for tumor suppression and overcoming Sora resistance and cardiotoxicity in HCC by modulating TRPM7. To our best knowledge, this study represents the first study to investigate the efficiency of CARV/ Sora on the HCC rat model. Moreover, no previous studies have reported the effect of inhibiting TRPM7 on HCC.
Enhancing Drug Efficacy
Hide/Show
Combination Pair ID: 165
Pair Name Dihydroartemisinin, Sorafenib
Phytochemical Dihydroartemisinin
Drug Sorafenib
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Down-regulation Glutathione synthetase Expression
Result DHA and Sora had the same mechanism, and the combined application of them could have a synergistic anti-tumor effect by inducing ferroptosis and inhibiting energy metabolism in HepG2 cells.
Combination Pair ID: 174
Pair Name Parthenolide, Etoposide
Phytochemical Parthenolide
Drug Etoposide
Disease Info [ICD-11: 2A60.Z] Acute myeloid leukemia Investigative
Regulate Info Up-regulation Glutathione synthetase Expression
Result Parthenolide did not limit the cytotoxic effect of etoposide in HL-60 cells even in the case of antagonistic interaction. If parthenolide does increase GSH levels in combination with etoposide in the normal hematopoietic cells, it could protect them against the pro-oxidative effects of this anti-cancer drug.
Combination Pair ID: 844
Pair Name Emodin, Cisplatin
Phytochemical Emodin
Drug Cisplatin
Disease Info [ICD-11: 2C94.Z] Bladder cancer Investigative
Regulate Info Down-regulation Glutathione synthetase Expression
Result This study revealed that emodin could increase the cisplatin-induced cytotoxicity against T24 and J82 cells via elevating the cellular ROS level and downregulating MRP1 expression. We suggest that emodin could serve as an effective adjuvant agent for the cisplatin-based chemotherapy of bladder cancer
Reversing Drug Resistance
Hide/Show
Combination Pair ID: 212
Pair Name Betulin, Gefitinib
Phytochemical Betulin
Drug Gefitinib
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Down-regulation Glutathione synthetase Expression
Result Co-treatment of betulin and gefitinib is effective against EGFR wild-type/KRAS-mutant non-small cell lung cancer by inducing ferroptosis
03. Reference
No. Title Href
1 Rutin and orlistat produce antitumor effects via antioxidant and apoptotic actions. Naunyn Schmiedebergs Arch Pharmacol. 2019 Feb;392(2):165-175. doi: 10.1007/s00210-018-1579-0. Click
2 Carvacrol enhances anti-tumor activity and mitigates cardiotoxicity of sorafenib in thioacetamide-induced hepatocellular carcinoma model through inhibiting TRPM7. Life Sci. 2023 Jul 1;324:121735. doi: 10.1016/j.lfs.2023.121735. Click
3 Dihydroartemisinin enhances the inhibitory effect of sorafenib on HepG2 cells by inducing ferroptosis and inhibiting energy metabolism. J Pharmacol Sci. 2022 Jan;148(1):73-85. doi: 10.1016/j.jphs.2021.09.008. Click
4 The role of oxidative stress in the cooperation of parthenolide and etoposide in HL-60 cells. Folia Med Cracov. 2020;60(4):5-17. Click
5 Emodin enhances cisplatin-induced cytotoxicity in human bladder cancer cells through ROS elevation and MRP1 downregulation. BMC Cancer. 2016;16:578. Published 2016 Aug 2. doi:10.1186/s12885-016-2640-3 Click
6 Co-treatment of betulin and gefitinib is effective against EGFR wild-type/KRAS-mutant non-small cell lung cancer by inducing ferroptosis. Neoplasma. 2022 May;69(3):648-656. doi: 10.4149/neo_2022_211103N1568. Click
It has been 558981 visits since 2024.08
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang
TOP