| Name | Glutathione synthetase | ||
| UniProt ID | GSHB_HUMAN | ||
| Gene Name | GSS | ||
| Gene ID | 2937 | ||
| Synonyms |
GSS, GSHS, HEL-S-64p, HEL-S-88n
|
||
| Sequence |
MATNWGSLLQDKQQLEELARQAVDRALAEGVLLRTSQEPTSSEVVSYAPFTLFPSLVPSA
LLEQAYAVQMDFNLLVDAVSQNAAFLEQTLSSTIKQDDFTARLFDIHKQVLKEGIAQTVF LGLNRSDYMFQRSADGSPALKQIEINTISASFGGLASRTPAVHRHVLSVLSKTKEAGKIL SNNPSKGLALGIAKAWELYGSPNALVLLIAQEKERNIFDQRAIENELLARNIHVIRRTFE DISEKGSLDQDRRLFVDGQEIAVVYFRDGYMPRQYSLQNWEARLLLERSHAAKCPDIATQ LAGTKKVQQELSRPGMLEMLLPGQPEAVARLRATFAGLYSLDVGEEGDQAIAEALAAPSR FVLKPQREGGGNNLYGEEMVQALKQLKDSEERASYILMEKIEPEPFENCLLRPGSPARVV QCISELGIFGVYVRQEKTLVMNKHVGHLLRTKAIEHADGGVAAGVAVLDNPYPV |
||
| Pathway Map | MAP LINK | ||
| T.C. Number | 2.A.16.5.2; 3.A.1.208.8; 3.A.1.5.27 | ||
| KEGG ID | hsa2937 | ||
| TTD ID | T69420 | ||
| Pfam | PF03199; PF03917 | ||
| Pair Name | Carvacrol, Sorafenib | |||
| Phytochemical Name | Carvacrol | |||
| Anticancer drug Name | Sorafenib | |||
| Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
| Regulate Info | Up-regulation | Glutathione synthetase | Expression | |
| Result | CARV/Sora is a promising combination for tumor suppression and overcoming Sora resistance and cardiotoxicity in HCC by modulating TRPM7. To our best knowledge, this study represents the first study to investigate the efficiency of CARV/ Sora on the HCC rat model. Moreover, no previous studies have reported the effect of inhibiting TRPM7 on HCC. | |||
| Pair Name | Rutin, Orlistat | |||
| Phytochemical Name | Rutin | |||
| Anticancer drug Name | Orlistat | |||
| Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
| Regulate Info | Up-regulation | Glutathione synthetase | Expression | |
| Result | Rutin and orlistat produce antitumor effects via antioxidant and apoptotic actions | |||
| Pair Name | Dihydroartemisinin, Sorafenib | |||
| Phytochemical | Dihydroartemisinin | |||
| Drug | Sorafenib | |||
| Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
| Regulate Info | Down-regulation | Glutathione synthetase | Expression | |
| Result | DHA and Sora had the same mechanism, and the combined application of them could have a synergistic anti-tumor effect by inducing ferroptosis and inhibiting energy metabolism in HepG2 cells. | |||
| Pair Name | Emodin, Cisplatin | |||
| Phytochemical | Emodin | |||
| Drug | Cisplatin | |||
| Disease Info | [ICD-11: 2C94] | Bladder cancer | Investigative | |
| Regulate Info | Down-regulation | Glutathione synthetase | Expression | |
| Result | This study revealed that emodin could increase the cisplatin-induced cytotoxicity against T24 and J82 cells via elevating the cellular ROS level and downregulating MRP1 expression. We suggest that emodin could serve as an effective adjuvant agent for the cisplatin-based chemotherapy of bladder cancer | |||
| Pair Name | Parthenolide, Etoposide | |||
| Phytochemical | Parthenolide | |||
| Drug | Etoposide | |||
| Disease Info | [ICD-11: 2A60.Z] | Acute myeloid leukemia | Investigative | |
| Regulate Info | Up-regulation | Glutathione synthetase | Expression | |
| Result | Parthenolide did not limit the cytotoxic effect of etoposide in HL-60 cells even in the case of antagonistic interaction. If parthenolide does increase GSH levels in combination with etoposide in the normal hematopoietic cells, it could protect them against the pro-oxidative effects of this anti-cancer drug. | |||
| Pair Name | Betulin, Gefitinib | |||
| Phytochemical | Betulin | |||
| Drug | Gefitinib | |||
| Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
| Regulate Info | Down-regulation | Glutathione synthetase | Expression | |
| Result | Co-treatment of betulin and gefitinib is effective against EGFR wild-type/KRAS-mutant non-small cell lung cancer by inducing ferroptosis | |||
| No. | Title | Href |
|---|---|---|
| 1 | Carvacrol enhances anti-tumor activity and mitigates cardiotoxicity of sorafenib in thioacetamide-induced hepatocellular carcinoma model through inhibiting TRPM7. Life Sci. 2023 Jul 1;324:121735. doi: 10.1016/j.lfs.2023.121735. | Click |
| 2 | Rutin and orlistat produce antitumor effects via antioxidant and apoptotic actions. Naunyn Schmiedebergs Arch Pharmacol. 2019 Feb;392(2):165-175. doi: 10.1007/s00210-018-1579-0. | Click |
| 3 | Dihydroartemisinin enhances the inhibitory effect of sorafenib on HepG2 cells by inducing ferroptosis and inhibiting energy metabolism. J Pharmacol Sci. 2022 Jan;148(1):73-85. doi: 10.1016/j.jphs.2021.09.008. | Click |
| 4 | Emodin enhances cisplatin-induced cytotoxicity in human bladder cancer cells through ROS elevation and MRP1 downregulation. BMC Cancer. 2016;16:578. Published 2016 Aug 2. doi:10.1186/s12885-016-2640-3 | Click |
| 5 | The role of oxidative stress in the cooperation of parthenolide and etoposide in HL-60 cells. Folia Med Cracov. 2020;60(4):5-17. | Click |
| 6 | Co-treatment of betulin and gefitinib is effective against EGFR wild-type/KRAS-mutant non-small cell lung cancer by inducing ferroptosis. Neoplasma. 2022 May;69(3):648-656. doi: 10.4149/neo_2022_211103N1568. | Click |
