
| Name | Inhibitor of nuclear factor kappa-B kinase | ||
| UniProt ID | IKKA_HUMAN | ||
| Gene Name | CHUK | ||
| Gene ID | 1147 | ||
| Synonyms |
CHUK, BPS2, IKBKA, IKK-1, IKK-alpha, IKK1, IKKA, NFKBIKA, TCF16
|
||
| Sequence |
MERPPGLRPGAGGPWEMRERLGTGGFGNVCLYQHRELDLKIAIKSCRLELSTKNRERWCH
EIQIMKKLNHANVVKACDVPEELNILIHDVPLLAMEYCSGGDLRKLLNKPENCCGLKESQ ILSLLSDIGSGIRYLHENKIIHRDLKPENIVLQDVGGKIIHKIIDLGYAKDVDQGSLCTS FVGTLQYLAPELFENKPYTATVDYWSFGTMVFECIAGYRPFLHHLQPFTWHEKIKKKDPK CIFACEEMSGEVRFSSHLPQPNSLCSLVVEPMENWLQLMLNWDPQQRGGPVDLTLKQPRC FVLMDHILNLKIVHILNMTSAKIISFLLPPDESLHSLQSRIERETGINTGSQELLSETGI SLDPRKPASQCVLDGVRGCDSYMVYLFDKSKTVYEGPFASRSLSDCVNYIVQDSKIQLPI IQLRKVWAEAVHYVSGLKEDYSRLFQGQRAAMLSLLRYNANLTKMKNTLISASQQLKAKL EFFHKSIQLDLERYSEQMTYGISSEKMLKAWKEMEEKAIHYAEVGVIGYLEDQIMSLHAE IMELQKSPYGRRQGDLMESLEQRAIDLYKQLKHRPSDHSYSDSTEMVKIIVHTVQSQDRV LKELFGHLSKLLGCKQKIIDLLPKVEVALSNIKEADNTVMFMQGKRQKEIWHLLKIACTQ SSARSLVGSSLEGAVTPQTSAWLPPTSAEHDHSLSCVVTPQDGETSAQMIEENLNCLGHL STIIHEANEEQGNSMMNLDWSWLTE |
||
| Pathway Map | MAP LINK | ||
| T.C. Number | 3.E.1.4.3; 9.B.285.1.4 | ||
| KEGG ID | hsa1147 | ||
| TTD ID | T65879 | ||
| Pfam | PF00069; PF06293; PF07714; PF12179; PF18396; PF18397 | ||
| Pair Name | Tectorigenin, Paclitaxel | |||
| Phytochemical | Tectorigenin | |||
| Drug | Paclitaxel | |||
| Disease Info | [ICD-11: 2C73] | Ovarian cancer | Investigative | |
| Regulate Info | Down-regulation | Inhibitor of nuclear factor kappa-B kinase | Phosphorylation | |
| Result | These data suggest that tectorigenin could sensitize paclitaxel-resistant human ovarian cancer cells through inactivation of the Akt/IKK/IκB/NFκB signaling pathway, and promise a new intervention to chemosensitize paclitaxel-induced cytotoxicity in ovarian cancer. | |||
| Pair Name | Tectorigenin, Paclitaxel | |||
| Phytochemical | Tectorigenin | |||
| Drug | Paclitaxel | |||
| Disease Info | [ICD-11: 2C73] | Ovarian cancer | Investigative | |
| Regulate Info | Down-regulation | Inhibitor of nuclear factor kappa-B kinase | Phosphorylation | |
| Result | These data suggest that tectorigenin could sensitize paclitaxel-resistant human ovarian cancer cells through inactivation of the Akt/IKK/IκB/NFκB signaling pathway, and promise a new intervention to chemosensitize paclitaxel-induced cytotoxicity in ovarian cancer. | |||
| Pair Name | Helichrysetin, Tumor necrosis factor-alpha | |||
| Phytochemical | Helichrysetin | |||
| Drug | Tumor necrosis factor-alpha | |||
| Disease Info | [ICD-11: 2F7Z] | Glioma | Investigative | |
| Regulate Info | Down-regulation | Inhibitor of nuclear factor kappa-B kinase | Phosphorylation | |
| Result | Helichrysetin and TNF‑α synergistically promoted apoptosis by inhibiting TAK1/IKK/NF‑κB and TAK1/EGFR signaling pathways in HeLa and T98G cells, indicating a potential therapeutic strategy for cancer. | |||
| Pair Name | Beta-Elemene, Fluorouracil | |||
| Phytochemical | Beta-Elemene | |||
| Drug | Fluorouracil | |||
| Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
| Regulate Info | Down-regulation | Inhibitor of nuclear factor kappa-B kinase | Expression | |
| Result | The conclusion obtained, considering that the results suggest that the combination may be important specifically in the treatment of TNBC. | |||
| Pair Name | Gedunin, Epalrestat | |||
| Phytochemical | Gedunin | |||
| Drug | Epalrestat | |||
| Disease Info | [ICD-11: 2B66.Z] | Oral cancer | Investigative | |
| Regulate Info | Down-regulation | Inhibitor of nuclear factor kappa-B kinase | Expression | |
| Result | Our results provide compelling evidence that the combination of gedunin and epalrestat modulates expression of key oncogenic signalling kinases and transcription factors primarily by influencing phosphorylation and subcellular localisation. AR inhibitors such as gedunin and epalrestat are novel candidate agents for cancer prevention and therapy. | |||
| Pair Name | Naringenin, Diosmin | |||
| Phytochemical | Naringenin | |||
| Drug | Diosmin | |||
| Disease Info | [ICD-11: 2B90.Z] | Colon cancer | Investigative | |
| Regulate Info | Down-regulation | Inhibitor of nuclear factor kappa-B kinase | Expression | |
| Result | Diosmin in combination with naringenin enhances apoptosis in colon cancer cells | |||
| Pair Name | Propyl gallate, Temozolomide | |||
| Phytochemical | Propyl gallate | |||
| Drug | Temozolomide | |||
| Disease Info | [ICD-11: 2A00] | Glioblastoma multiforme | Investigative | |
| Regulate Info | Down-regulation | Inhibitor of nuclear factor kappa-B kinase | Phosphorylation | |
| Result | Propyl Gallate Exerts an Antimigration Effect on Temozolomide-Treated Malignant Glioma Cells through Inhibition of ROS and the NF- κ B Pathway | |||
| No. | Title | Href |
|---|---|---|
| 1 | Tectorigenin sensitizes paclitaxel-resistant human ovarian cancer cells through downregulation of the Akt and NFκB pathway. Carcinogenesis. 2012 Dec;33(12):2488-98. doi: 10.1093/carcin/bgs302. | Click |
| 2 | Tectorigenin sensitizes paclitaxel-resistant human ovarian cancer cells through downregulation of the Akt and NFκB pathway. Carcinogenesis. 2012 Dec;33(12):2488-98. doi: 10.1093/carcin/bgs302. | Click |
| 3 | Helichrysetin and TNF‑α synergistically promote apoptosis by inhibiting overactivation of the NF‑κB and EGFR signaling pathways in HeLa and T98G cells. Int J Mol Med. 2021 Apr;47(4):49. doi: 10.3892/ijmm.2021.4882. | Click |
| 4 | β-Elemene Enhances the Chemotherapeutic Effect of 5-Fluorouracil in Triple-Negative Breast Cancer via PI3K/AKT, RAF-MEK-ErK, and NF-κB Signaling Pathways. Onco Targets Ther. 2020 Jun 9;13:5207-5222. doi: 10.2147/OTT.S242820. | Click |
| 5 | Gedunin, A Neem Limonoid in Combination with Epalrestat Inhibits Cancer Hallmarks by Attenuating Aldose Reductase-Driven Oncogenic Signaling in SCC131 Oral Cancer Cells. Anticancer Agents Med Chem. 2018;18(14):2042-2052. doi: 10.2174/1871520618666180731093433. | Click |
| 6 | Diosmin in combination with naringenin enhances apoptosis in colon cancer cells. Oncol Rep. 2022 Jan;47(1):4. doi: 10.3892/or.2021.8215. | Click |
| 7 | Propyl Gallate Exerts an Antimigration Effect on Temozolomide-Treated Malignant Glioma Cells through Inhibition of ROS and the NF-κB Pathway. J Immunol Res. 2017;2017:9489383. doi: 10.1155/2017/9489383. | Click |