| Name | Baculoviral IAP repeat-containing protein 3 | ||
| UniProt ID | BIRC3_HUMAN | ||
| Gene Name | BIRC3 | ||
| Gene ID | 330 | ||
| Synonyms |
BIRC3, AIP1, API2, CIAP2, HAIP1, HIAP1, IAP-1, MALT2, MIHC, RNF49, c-IAP2
|
||
| Sequence |
MNIVENSIFLSNLMKSANTFELKYDLSCELYRMSTYSTFPAGVPVSERSLARAGFYYTGV
NDKVKCFCCGLMLDNWKRGDSPTEKHKKLYPSCRFVQSLNSVNNLEATSQPTFPSSVTNS THSLLPGTENSGYFRGSYSNSPSNPVNSRANQDFSALMRSSYHCAMNNENARLLTFQTWP LTFLSPTDLAKAGFYYIGPGDRVACFACGGKLSNWEPKDNAMSEHLRHFPKCPFIENQLQ DTSRYTVSNLSMQTHAARFKTFFNWPSSVLVNPEQLASAGFYYVGNSDDVKCFCCDGGLR CWESGDDPWVQHAKWFPRCEYLIRIKGQEFIRQVQASYPHLLEQLLSTSDSPGDENAESS IIHFEPGEDHSEDAIMMNTPVINAAVEMGFSRSLVKQTVQRKILATGENYRLVNDLVLDL LNAEDEIREEERERATEEKESNDLLLIRKNRMALFQHLTCVIPILDSLLTAGIINEQEHD VIKQKTQTSLQARELIDTILVKGNIAATVFRNSLQEAEAVLYEHLFVQQDIKYIPTEDVS DLPVEEQLRRLQEERTCKVCMDKEVSIVFIPCGHLVVCKDCAPSLRKCPICRSTIKGTVR TFLS |
||
| Pathway Map | MAP LINK | ||
| KEGG ID | hsa330 | ||
| TTD ID | T35173 | ||
| Pfam | PF00619; PF00653; PF10217; PF13639; PF13920; PF13923; PF14441; PF14447; PF14634; PF21290 | ||
| Pair Name | Epigallocatechin gallate, TNF-related apoptosis inducing ligand | |||
| Phytochemical | Epigallocatechin gallate | |||
| Drug | TNF-related apoptosis inducing ligand | |||
| Disease Info | [ICD-11: 2C82] | Prostate cancer | Investigative | |
| Regulate Info | Down-regulation | Baculoviral IAP repeat-containing protein 3 | Expression | |
| Result | EGCG sensitizes human prostate carcinoma LNCaP cells to TRAIL-mediated apoptosis and synergistically inhibits biomarkers associated with angiogenesis and metastasis | |||
| Pair Name | Epigallocatechin gallate, Vorinostat | |||
| Phytochemical | Epigallocatechin gallate | |||
| Drug | Vorinostat | |||
| Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
| Regulate Info | Down-regulation | Baculoviral IAP repeat-containing protein 3 | Expression | |
| Result | The compounds were able to decrease the expression of cIAP2 while increasing the expression of pro-apoptotic caspase 7. There were also changes in histone modifications, suggesting a role of epigenetic mechanisms in these changes in expression of cIAP2. These changes resulted in an increase in apoptosis. SAHA and EGCG were also capable of limiting TNBC cell migration across a fibronectin (FN) matrix. | |||
| Pair Name | Gamma-Tocotrienol, Capecitabine | |||
| Phytochemical | Gamma-Tocotrienol | |||
| Drug | Capecitabine | |||
| Disease Info | [ICD-11: 2B91] | Colorectal cancer | Investigative | |
| Regulate Info | Down-regulation | Baculoviral IAP repeat-containing protein 3 | Expression | |
| Result | Our findings suggest that γ-T3 inhibited the growth of human CRC and sensitised CRC to capecitabine by regulating proteins linked to tumourigenesis. | |||
| Pair Name | Gamma-Tocotrienol, Docetaxel | |||
| Phytochemical | Gamma-Tocotrienol | |||
| Drug | Docetaxel | |||
| Disease Info | [ICD-11: 2B66.Z] | Oral cancer | Investigative | |
| Regulate Info | Down-regulation | Baculoviral IAP repeat-containing protein 3 | Expression | |
| Result | These findings suggest that the combination treatment with these agents may provide enhanced therapeutic response in oral cancer patients, while avoiding the toxicity associated with high-dose β-tubulin stabilization monotherapy. | |||
| Pair Name | Ginsenoside Rg5, Paclitaxel | |||
| Phytochemical | Ginsenoside Rg5 | |||
| Drug | Paclitaxel | |||
| Disease Info | [ICD-11: 2C77] | Cervical cancer | Investigative | |
| Regulate Info | Down-regulation | Baculoviral IAP repeat-containing protein 3 | Expression | |
| Result | Ginsenoside Rg5 Sensitizes Paclitaxel-Resistant Human Cervical-Adeno-Carcinoma Cells to Paclitaxel-And Enhances the Anticancer Effect of Paclitaxel | |||
| Pair Name | Gossypol, Zoledronic acid | |||
| Phytochemical | Gossypol | |||
| Drug | Zoledronic acid | |||
| Disease Info | [ICD-11: 2C82] | Prostate cancer | Investigative | |
| Regulate Info | Down-regulation | Baculoviral IAP repeat-containing protein 3 | Expression | |
| Result | GP significantly enhances the anti-tumor activity of ZA in hormone- and drug-resistant prostate cancer cells by targeting many pivotal apoptosis-related proteins. | |||
| Pair Name | Kaempferol, TNF-related apoptosis inducing ligand | |||
| Phytochemical | Kaempferol | |||
| Drug | TNF-related apoptosis inducing ligand | |||
| Disease Info | [ICD-11: 2A20.1] | Chronic myelogenous leukemia | Investigative | |
| Regulate Info | Down-regulation | Baculoviral IAP repeat-containing protein 3 | Expression | |
| Result | It is reasonable to conclude that sensitization of chronic leukemia cells to TRAIL by kaempferol in vitro should be considered as a way of focusing clinical attention on leukemia therapy. | |||
| Pair Name | Morin, Auranofin | |||
| Phytochemical | Morin | |||
| Drug | Auranofin | |||
| Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
| Regulate Info | Down-regulation | Baculoviral IAP repeat-containing protein 3 | Expression | |
| Result | This study provides evidence that morin can enhance the anticancer activity of AF in Hep3B human hepatocellular carcinoma cells, indicating that its combination could be an alternative treatment strategy for the hepatocellular carcinoma. | |||
| Pair Name | OSW-1, Carboplatin | |||
| Phytochemical | OSW-1 | |||
| Drug | Carboplatin | |||
| Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
| Regulate Info | Down-regulation | Baculoviral IAP repeat-containing protein 3 | Expression | |
| Result | Our data revealed the mode of action and molecular mechanism underlying the effect of OSW-1 against TNBC, and provided a useful guidance for improving the sensitivity of TNBC cells to conventional chemotherapeutic drugs, which warrants further investigation. | |||
| Pair Name | Oxymatrine, Paclitaxel | |||
| Phytochemical | Oxymatrine | |||
| Drug | Paclitaxel | |||
| Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
| Regulate Info | Down-regulation | Baculoviral IAP repeat-containing protein 3 | Expression | |
| Result | Oxymatrine Attenuates Tumor Growth and Deactivates STAT5 Signaling in a Lung Cancer Xenograft Model | |||
| No. | Title | Href |
|---|---|---|
| 1 | Green tea polyphenol EGCG sensitizes human prostate carcinoma LNCaP cells to TRAIL-mediated apoptosis and synergistically inhibits biomarkers associated with angiogenesis and metastasis. Oncogene. 2008 Mar 27;27(14):2055-63. doi: 10.1038/sj.onc.1210840. | Click |
| 2 | SAHA and EGCG Promote Apoptosis in Triple-negative Breast Cancer Cells, Possibly Through the Modulation of cIAP2. Anticancer Res. 2020 Jan;40(1):9-26. doi: 10.21873/anticanres.13922. | Click |
| 3 | γ-Tocotrienol suppresses growth and sensitises human colorectal tumours to capecitabine in a nude mouse xenograft model by down-regulating multiple molecules. Br J Cancer. 2016 Sep 27;115(7):814-24. doi: 10.1038/bjc.2016.257. | Click |
| 4 | γ-tocotrienol enhances the chemosensitivity of human oral cancer cells to docetaxel through the downregulation of the expression of NF-κB-regulated anti-apoptotic gene products. Int J Oncol. 2013;42(1):75-82. doi:10.3892/ijo.2012.1692 through the downregulation of the expression of NF-κB-regulated anti-apoptotic gene products. Int J Oncol. 2013;42(1):75-82. doi:10.3892/ijo.2012.1692 | Click |
| 5 | Ginsenoside Rg5 Sensitizes Paclitaxel-Resistant Human Cervical-Adeno-Carcinoma Cells to Paclitaxel-And Enhances the Anticancer Effect of Paclitaxel. Genes (Basel). 2022 Jun 24;13(7):1142. doi: 10.3390/genes13071142. | Click |
| 6 | Targeting apoptosis in the hormone- and drug-resistant prostate cancer cell line, DU-145, by gossypol/zoledronic acid combination. Cell Biol Int. 2009 Nov;33(11):1165-72. doi: 10.1016/j.cellbi.2009.08.006. | Click |
| 7 | Kaempferol sensitizes tumor necrosis factor-related apoptosis-inducing ligand-resistance chronic myelogenous leukemia cells to apoptosis. Mol Biol Rep. 2022 Jan;49(1):19-29. doi: 10.1007/s11033-021-06778-z. | Click |
| 8 | Morin enhances auranofin anticancer activity by up-regulation of DR4 and DR5 and modulation of Bcl-2 through reactive oxygen species generation in Hep3B human hepatocellular carcinoma cells. Phytother Res. 2019 May;33(5):1384-1393. doi: 10.1002/ptr.6329. | Click |
| 9 | OSW-1 induces apoptosis and cyto-protective autophagy, and synergizes with chemotherapy on triple negative breast cancer metastasis. Cell Oncol (Dordr). 2022 Dec;45(6):1255-1275. doi: 10.1007/s13402-022-00716-2. | Click |
| 10 | Oxymatrine Attenuates Tumor Growth and Deactivates STAT5 Signaling in a Lung Cancer Xenograft Model. Cancers (Basel). 2019 Jan 7;11(1):49. doi: 10.3390/cancers11010049. | Click |
