
| Name | Bcl-2-like protein 11 | ||
| UniProt ID | B2L11_HUMAN | ||
| Gene Name | BIM | ||
| Gene ID | 10018 | ||
| Synonyms |
BCL2L11, BAM, BIM, BOD
|
||
| Sequence |
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSP
QGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPP CQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPR MVILRLLRYIVRLVWRMH |
||
| Pathway Map | MAP LINK | ||
| T.C. Number | 8.A.69.1.1 | ||
| KEGG ID | hsa10018 | ||
| Pfam | PF06773; PF08945 | ||
| Pair Name | Genipin, Oxaliplatin | |||
| Phytochemical Name | Genipin | |||
| Anticancer drug Name | Oxaliplatin | |||
| Disease Info | [ICD-11: 2B91.Z] | Colorectal cancer | Investigative | |
| Regulate Info | Up-regulation | Bcl-2-like protein 11 | Expression | |
| Result | These findings suggest that genipin may be a novel agent for increasing the sensitivity of oxaliplatin against colorectal cancer. The combination of oxaliplatin and genipin hold significant therapeutic potential with minimal adverse effects. | |||
| Pair Name | Nobiletin, Vorinostat | |||
| Phytochemical | Nobiletin | |||
| Drug | Vorinostat | |||
| Disease Info | [ICD-11: 2C25.Z] | Lung cancer | Investigative | |
| Regulate Info | Up-regulation | Bcl-2-like protein 11 | Expression | |
| Result | The combination of nobiletin with vorinostat increased histone H3K9 and H3K27 acetylation levels in SCLC mouse tumor tissue and enhanced the expression of the BH3-only proteins BIM and BID. We conclude that nobiletin is a novel natural BH3 mimetic that can cooperate with vorinostat to induce apoptosis and autophagy in SCLC. | |||
| Pair Name | Flavokawain A, Herceptin | |||
| Phytochemical | Flavokawain A | |||
| Drug | Herceptin | |||
| Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
| Regulate Info | Up-regulation | Bcl-2-like protein 11 | Expression | |
| Result | Our results suggest FKA as a promising and novel apoptosis inducer and G2 blocking agent that, in combination with Herceptin, enhances for the treatment of HER2-overexpressing breast cancer. | |||
| Pair Name | Oridonin, Venetoclax | |||
| Phytochemical | Oridonin | |||
| Drug | Venetoclax | |||
| Disease Info | [ICD-11: 2A60.Z] | Acute myeloid leukemia | Investigative | |
| Regulate Info | Up-regulation | Bcl-2-like protein 11 | Expression | |
| Result | Oridonin and venetoclax synergistically promote AML cell apoptosis by inhibiting AKT signaling. | |||
| Pair Name | Ursolic acid, Sorafenib | |||
| Phytochemical | Ursolic acid | |||
| Drug | Sorafenib | |||
| Disease Info | [ICD-11: 2A00-2F9Z] | Solid tumour or cancer | Investigative | |
| Regulate Info | Up-regulation | Bcl-2-like protein 11 | Expression | |
| Result | These results suggest that the synergistic antitumor effects of sorafenib combined with ursolic acid may involve the induction of Mcl-1-related apoptosis and SLC7A11-dependent ferroptosis. Our findings may offer a novel effective therapeutic strategy for tumor treatment. | |||
| Pair Name | Britannin, Vincristine | |||
| Phytochemical | Britannin | |||
| Drug | Vincristine | |||
| Disease Info | [ICD-11: 2B33.3] | Acute lymphoblastic leukemia | Investigative | |
| Regulate Info | Up-regulation | Bcl-2-like protein 11 | Expression | |
| Result | The results of this study showed for the first time that Britannin, as a natural Sesquiterpene Lactone, has cytotoxic effects that could be considered as an anti-leukemic agent in the treatment of ALL. However, there is still a demand for further studies that examine the efficacy and the safety of this purified compound. | |||
| Pair Name | Platycodin D, Venetoclax | |||
| Phytochemical | Platycodin D | |||
| Drug | Venetoclax | |||
| Disease Info | [ICD-11: 2A60.Z] | Acute myeloid leukemia | Investigative | |
| Regulate Info | Up-regulation | Bcl-2-like protein 11 | Expression | |
| Result | Platycodin D may be a potent therapeutic candidate for the treatment of AML | |||
| Pair Name | Platycodin D, Sorafenib | |||
| Phytochemical | Platycodin D | |||
| Drug | Sorafenib | |||
| Disease Info | [ICD-11: 2C82.0] | Prostate cancer | Investigative | |
| Regulate Info | Up-regulation | Bcl-2-like protein 11 | Expression | |
| Result | The combination of Platycodin D and sorafenib may exert potent anti-cancer effects specifically via FOXO3a | |||
| No. | Title | Href |
|---|---|---|
| 1 | Genipin Enhances the Therapeutic Effects of Oxaliplatin by Upregulating BIM in Colorectal Cancer. Mol Cancer Ther. 2019 Apr;18(4):751-761. doi: 10.1158/1535-7163.MCT-18-0196. | Click |
| 2 | The novel small molecule BH3 mimetic nobiletin synergizes with vorinostat to induce apoptosis and autophagy in small cell lung cancer. Biochem Pharmacol. 2023 Oct;216:115807. doi: 10.1016/j.bcp.2023.115807. | Click |
| 3 | Induction of G2M Arrest by Flavokawain A, a Kava Chalcone, Increases the Responsiveness of HER2-Overexpressing Breast Cancer Cells to Herceptin. Molecules. 2017 Mar 14;22(3):462. doi: 10.3390/molecules22030462. | Click |
| 4 | Oridonin Synergistically Enhances the Pro-Apoptotic Effect of Venetoclax on Acute Myeloid Leukemia Cells by Inhibiting AKT Signaling. Front Biosci (Landmark Ed). 2023 Sep 6;28(9):195. doi: 10.31083/j.fbl2809195. | Click |
| 5 | Ursolic acid enhances the antitumor effects of sorafenib associated with Mcl-1-related apoptosis and SLC7A11-dependent ferroptosis in human cancer. Pharmacol Res. 2022 Aug;182:106306. doi: 10.1016/j.phrs.2022.106306. | Click |
| 6 | Britannin a Sesquiterpene Lactone from Inula aucheriana Exerted an Anti-leukemic Effect in Acute Lymphoblastic Leukemia (ALL) Cells and Enhanced the Sensitivity of the Cells to Vincristine. Nutr Cancer. 2022;74(3):965-977. doi: 10.1080/01635581.2021.1931700. | Click |
| 7 | Platycodin D induces apoptotic cell death through PI3K/AKT and MAPK/ERK pathways and synergizes with venetoclax in acute myeloid leukemia. Eur J Pharmacol. 2023 Oct 5;956:175957. doi: 10.1016/j.ejphar.2023.175957. | Click |
| 8 | Combined Anti-Cancer Effects of Platycodin D and Sorafenib on Androgen-Independent and PTEN-Deficient Prostate Cancer. Front Oncol. 2021 May 7;11:648985. doi: 10.3389/fonc.2021.648985. | Click |