TOP
Nav Bar
  1. General Info
  2. Effects Info
  3. Reference
Molecular Details
01. General Information
Name Autophagy protein 5
UniProt ID ATG5_HUMAN
Gene Name ATG5
Gene ID 9474
Synonyms
ATG5, APG5, APG5-LIKE, APG5L, ASP, SCAR25, hAPG5
Sequence
MTDDKDVLRDVWFGRIPTCFTLYQDEITEREAEPYYLLLPRVSYLTLVTDKVKKHFQKVM
RQEDISEIWFEYEGTPLKWHYPIGLLFDLLASSSALPWNITVHFKSFPEKDLLHCPSKDA
IEAHFMSCMKEADALKHKSQVINEMQKKDHKQLWMGLQNDRFDQFWAINRKLMEYPAEEN
GFRYIPFRIYQTTTERPFIQKLFRPVAADGQLHTLGDLLKEVCPSAIDPEDGEKKNQVMI
HGIEPMLETPLQWLSEHLSYPDNFLHISIIPQPTD
Pathway Map MAP LINK
KEGG ID hsa9474
Pfam PF04106; PF20573; PF20637; PF20638
02. Combinatorial Therapeutic Effect(s)
Synergistic Effect
Hide/Show
Decreasing Drug Toxicity
Hide/Show
Combination Pair ID: 600
Pair Name Escin, Sorafenib
Phytochemical Name Escin
Anticancer drug Name Sorafenib
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Down-regulation Autophagy protein 5 Expression
Result This combination also selectively targeted G0/G1 phase of cancer cells. In in vivo study, the combination reduced tumour load and lower elevated serum biochemical parameters. The combination of sorafenib/escin synergistically inhibits autophagy to induce late apoptosis in lung cancer cells' G0/G1 phase.
Enhancing Drug Efficacy
Hide/Show
Combination Pair ID: 2
Pair Name Camptothecin, Rapamycin
Phytochemical Camptothecin
Drug Rapamycin
Disease Info [ICD-11: 2C73] Ovarian cancer Investigative
Regulate Info Up-regulation Autophagy protein 5 Expression
Result Autophagy-induced intracellular signaling fractional nano-drug system for synergistic anti-tumor therapy
Combination Pair ID: 119
Pair Name Morin Hydrate, Cisplatin
Phytochemical Morin Hydrate
Drug Cisplatin
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Down-regulation Autophagy protein 5 Expression
Result Our findings indicate that CP-Mh in combination served as a prominent regulator of autophagy and significant inducer of apoptosis that maintains a homeostatic balance towards HepG2 cells and the subcutaneous tumor model.
Combination Pair ID: 190
Pair Name Ursolic acid, Epirubicin
Phytochemical Ursolic acid
Drug Epirubicin
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Autophagy protein 5 Expression
Result These findings indicate that UA can dramatically enhance the sensitivity of MCF-7 and MDA-MB-231 cells to EPI by modulating the autophagy pathway. Our study may provide a new therapeutic strategy for combination therapy.
Combination Pair ID: 232
Pair Name AKBA, Cisplatin
Phytochemical AKBA
Drug Cisplatin
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Down-regulation Autophagy protein 5 Expression
Result Acetyl-11-keto-beta-boswellic acid enhances the cisplatin sensitivity of non-small cell lung cancer cells through cell cycle arrest, apoptosis induction, and autophagy suppression via p21-dependent signaling pathway
Combination Pair ID: 374
Pair Name Resveratrol, Talazoparib
Phytochemical Resveratrol
Drug Talazoparib
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Autophagy protein 5 Expression
Result Resveratrol sensitizes breast cancer to PARP inhibitor, talazoparib through dual inhibition of AKT and autophagy flux
Combination Pair ID: 442
Pair Name alpha-Mangostin, Sorafenib
Phytochemical alpha-Mangostin
Drug Sorafenib
Disease Info [ICD-11: 2C30] Melanoma Investigative
Regulate Info Down-regulation Autophagy protein 5 Expression
Result These data demonstrate an unanticipated synergy between α-Mangostin and sorafenib, with mechanistic actions that convert a known safe natural product to a candidate combinatorial therapeutic agent.
Reversing Drug Resistance
Hide/Show
Combination Pair ID: 127
Pair Name Epigallocatechin gallate, Gefitinib
Phytochemical Epigallocatechin gallate
Drug Gefitinib
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Down-regulation Autophagy protein 5 Expression
Result EGCG overcomes Gef resistance by inhibiting autophagy and augmenting cell death through targeting ERK pathway in NSCLC. Gef and EGCG combination therapy may be an effective strategy to overcome acquired resistance in NSCLC.
03. Reference
No. Title Href
1 Escin enhanced the efficacy of sorafenib by autophagy-mediated apoptosis in lung cancer cells. Phytother Res. 2023 Oct;37(10):4819-4837. doi: 10.1002/ptr.7948. Click
2 Autophagy-induced intracellular signaling fractional nano-drug system for synergistic anti-tumor therapy. J Colloid Interface Sci. 2023 Sep;645:986-996. doi: 10.1016/j.jcis.2023.05.031. Click
3 Morin Hydrate Sensitizes Hepatoma Cells and Xenograft Tumor towards Cisplatin by Downregulating PARP-1-HMGB1 Mediated Autophagy. Int J Mol Sci. 2020 Nov 4;21(21):8253. doi: 10.3390/ijms21218253. Click
4 Ursolic Acid Enhances the Sensitivity of MCF-7 and MDA-MB-231 Cells to Epirubicin by Modulating the Autophagy Pathway. Molecules. 2022 May 25;27(11):3399. doi: 10.3390/molecules27113399. Click
5 Acetyl-11-keto-β-boswellic acid enhances the cisplatin sensitivity of non-small cell lung cancer cells through cell cycle arrest, apoptosis induction, and autophagy suppression via p21-dependent signaling pathway. Cell Biol Toxicol. 2021 Apr;37(2):209-228. doi: 10.1007/s10565-020-09541-5. Click
6 Resveratrol sensitizes breast cancer to PARP inhibitor, talazoparib through dual inhibition of AKT and autophagy flux. Biochem Pharmacol. 2022 May;199:115024. doi: 10.1016/j.bcp.2022.115024. Click
7 Inhibition of Cell Proliferation in an NRAS Mutant Melanoma Cell Line by Combining Sorafenib and α-Mangostin. PLoS One. 2016 May 6;11(5):e0155217. doi: 10.1371/journal.pone.0155217. Click
8 EGCG overcomes gefitinib resistance by inhibiting autophagy and augmenting cell death through targeting ERK phosphorylation in NSCLC. Onco Targets Ther. 2019 Jul 26;12:6033-6043. doi: 10.2147/OTT.S209441. Click
It has been 487361 visits since 2024.08
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang
TOP