InterPAD - DETAILS

MTDDKDVLRDVWFGRIPTCFTLYQDEITEREAEPYYLLLPRVSYLTLVTDKVKKHFQKVM
RQEDISEIWFEYEGTPLKWHYPIGLLFDLLASSSALPWNITVHFKSFPEKDLLHCPSKDA
IEAHFMSCMKEADALKHKSQVINEMQKKDHKQLWMGLQNDRFDQFWAINRKLMEYPAEEN
GFRYIPFRIYQTTTERPFIQKLFRPVAADGQLHTLGDLLKEVCPSAIDPEDGEKKNQVMI
HGIEPMLETPLQWLSEHLSYPDNFLHISIIPQPTD

No.	Title	Href
1	Escin enhanced the efficacy of sorafenib by autophagy-mediated apoptosis in lung cancer cells. Phytother Res. 2023 Oct;37(10):4819-4837. doi: 10.1002/ptr.7948.	`Click`
2	Acetyl-11-keto-β-boswellic acid enhances the cisplatin sensitivity of non-small cell lung cancer cells through cell cycle arrest, apoptosis induction, and autophagy suppression via p21-dependent signaling pathway. Cell Biol Toxicol. 2021 Apr;37(2):209-228. doi: 10.1007/s10565-020-09541-5.	`Click`
3	Inhibition of Cell Proliferation in an NRAS Mutant Melanoma Cell Line by Combining Sorafenib and α-Mangostin. PLoS One. 2016 May 6;11(5):e0155217. doi: 10.1371/journal.pone.0155217.	`Click`
4	Autophagy-induced intracellular signaling fractional nano-drug system for synergistic anti-tumor therapy. J Colloid Interface Sci. 2023 Sep;645:986-996. doi: 10.1016/j.jcis.2023.05.031.	`Click`
5	Morin Hydrate Sensitizes Hepatoma Cells and Xenograft Tumor towards Cisplatin by Downregulating PARP-1-HMGB1 Mediated Autophagy. Int J Mol Sci. 2020 Nov 4;21(21):8253. doi: 10.3390/ijms21218253.	`Click`
6	Resveratrol sensitizes breast cancer to PARP inhibitor, talazoparib through dual inhibition of AKT and autophagy flux. Biochem Pharmacol. 2022 May;199:115024. doi: 10.1016/j.bcp.2022.115024.	`Click`
7	Ursolic Acid Enhances the Sensitivity of MCF-7 and MDA-MB-231 Cells to Epirubicin by Modulating the Autophagy Pathway. Molecules. 2022 May 25;27(11):3399. doi: 10.3390/molecules27113399.	`Click`
8	EGCG overcomes gefitinib resistance by inhibiting autophagy and augmenting cell death through targeting ERK phosphorylation in NSCLC. Onco Targets Ther. 2019 Jul 26;12:6033-6043. doi: 10.2147/OTT.S209441.	`Click`

No.

Title

Href

Escin enhanced the efficacy of sorafenib by autophagy-mediated apoptosis in lung cancer cells. Phytother Res. 2023 Oct;37(10):4819-4837. doi: 10.1002/ptr.7948.

Click

Acetyl-11-keto-β-boswellic acid enhances the cisplatin sensitivity of non-small cell lung cancer cells through cell cycle arrest, apoptosis induction, and autophagy suppression via p21-dependent signaling pathway. Cell Biol Toxicol. 2021 Apr;37(2):209-228. doi: 10.1007/s10565-020-09541-5.

Click

Inhibition of Cell Proliferation in an NRAS Mutant Melanoma Cell Line by Combining Sorafenib and α-Mangostin. PLoS One. 2016 May 6;11(5):e0155217. doi: 10.1371/journal.pone.0155217.

Click

Autophagy-induced intracellular signaling fractional nano-drug system for synergistic anti-tumor therapy. J Colloid Interface Sci. 2023 Sep;645:986-996. doi: 10.1016/j.jcis.2023.05.031.

Click

Morin Hydrate Sensitizes Hepatoma Cells and Xenograft Tumor towards Cisplatin by Downregulating PARP-1-HMGB1 Mediated Autophagy. Int J Mol Sci. 2020 Nov 4;21(21):8253. doi: 10.3390/ijms21218253.

Click

Resveratrol sensitizes breast cancer to PARP inhibitor, talazoparib through dual inhibition of AKT and autophagy flux. Biochem Pharmacol. 2022 May;199:115024. doi: 10.1016/j.bcp.2022.115024.

Click

Ursolic Acid Enhances the Sensitivity of MCF-7 and MDA-MB-231 Cells to Epirubicin by Modulating the Autophagy Pathway. Molecules. 2022 May 25;27(11):3399. doi: 10.3390/molecules27113399.

Click

EGCG overcomes gefitinib resistance by inhibiting autophagy and augmenting cell death through targeting ERK phosphorylation in NSCLC. Onco Targets Ther. 2019 Jul 26;12:6033-6043. doi: 10.2147/OTT.S209441.

Click

Name	Autophagy protein 5
UniProt ID	ATG5_HUMAN
Gene Name	ATG5
Gene ID	9474
Synonyms	ATG5, APG5, APG5-LIKE, APG5L, ASP, SCAR25, hAPG5
Sequence	MTDDKDVLRDVWFGRIPTCFTLYQDEITEREAEPYYLLLPRVSYLTLVTDKVKKHFQKVM RQEDISEIWFEYEGTPLKWHYPIGLLFDLLASSSALPWNITVHFKSFPEKDLLHCPSKDA IEAHFMSCMKEADALKHKSQVINEMQKKDHKQLWMGLQNDRFDQFWAINRKLMEYPAEEN GFRYIPFRIYQTTTERPFIQKLFRPVAADGQLHTLGDLLKEVCPSAIDPEDGEKKNQVMI HGIEPMLETPLQWLSEHLSYPDNFLHISIIPQPTD
Pathway Map	`MAP LINK`
KEGG ID	hsa9474
Pfam	PF04106; PF20573; PF20637; PF20638

Pair Name	Escin, Sorafenib
Phytochemical Name	Escin
Anticancer drug Name	Sorafenib
Disease Info	[ICD-11: 2C25]	Lung cancer	Investigative
Regulate Info	Down-regulation	Autophagy protein 5	Expression
Result	This combination also selectively targeted G0/G1 phase of cancer cells. In in vivo study, the combination reduced tumour load and lower elevated serum biochemical parameters. The combination of sorafenib/escin synergistically inhibits autophagy to induce late apoptosis in lung cancer cells' G0/G1 phase.

Pair Name	AKBA, Cisplatin
Phytochemical	AKBA
Drug	Cisplatin
Disease Info	[ICD-11: 2C25]	Lung cancer	Investigative
Regulate Info	Down-regulation	Autophagy protein 5	Expression
Result	Acetyl-11-keto-beta-boswellic acid enhances the cisplatin sensitivity of non-small cell lung cancer cells through cell cycle arrest, apoptosis induction, and autophagy suppression via p21-dependent signaling pathway

Pair Name	alpha-Mangostin, Sorafenib
Phytochemical	alpha-Mangostin
Drug	Sorafenib
Disease Info	[ICD-11: 2C30]	Melanoma	Investigative
Regulate Info	Down-regulation	Autophagy protein 5	Expression
Result	These data demonstrate an unanticipated synergy between α-Mangostin and sorafenib, with mechanistic actions that convert a known safe natural product to a candidate combinatorial therapeutic agent.

Pair Name	Camptothecin, Rapamycin
Phytochemical	Camptothecin
Drug	Rapamycin
Disease Info	[ICD-11: 2C73]	Ovarian cancer	Investigative
Regulate Info	Up-regulation	Autophagy protein 5	Expression
Result	Autophagy-induced intracellular signaling fractional nano-drug system for synergistic anti-tumor therapy

Pair Name	Morin Hydrate, Cisplatin
Phytochemical	Morin Hydrate
Drug	Cisplatin
Disease Info	[ICD-11: 2C12]	Hepatocellular carcinoma	Investigative
Regulate Info	Down-regulation	Autophagy protein 5	Expression
Result	Our findings indicate that CP-Mh in combination served as a prominent regulator of autophagy and significant inducer of apoptosis that maintains a homeostatic balance towards HepG2 cells and the subcutaneous tumor model.

Pair Name	Resveratrol, Talazoparib
Phytochemical	Resveratrol
Drug	Talazoparib
Disease Info	[ICD-11: 2C60]	Breast cancer	Investigative
Regulate Info	Up-regulation	Autophagy protein 5	Expression
Result	Resveratrol sensitizes breast cancer to PARP inhibitor, talazoparib through dual inhibition of AKT and autophagy flux

Pair Name	Ursolic acid, Epirubicin
Phytochemical	Ursolic acid
Drug	Epirubicin
Disease Info	[ICD-11: 2C60]	Breast cancer	Investigative
Regulate Info	Up-regulation	Autophagy protein 5	Expression
Result	These findings indicate that UA can dramatically enhance the sensitivity of MCF-7 and MDA-MB-231 cells to EPI by modulating the autophagy pathway. Our study may provide a new therapeutic strategy for combination therapy.

Pair Name	Epigallocatechin gallate, Gefitinib
Phytochemical	Epigallocatechin gallate
Drug	Gefitinib
Disease Info	[ICD-11: 2C25]	Lung cancer	Investigative
Regulate Info	Down-regulation	Autophagy protein 5	Expression
Result	EGCG overcomes Gef resistance by inhibiting autophagy and augmenting cell death through targeting ERK pathway in NSCLC. Gef and EGCG combination therapy may be an effective strategy to overcome acquired resistance in NSCLC.