| Name | Pyruvate kinase PKM | ||
| UniProt ID | KPYM_HUMAN | ||
| Gene Name | PKM | ||
| Gene ID | 5315 | ||
| Synonyms |
PKM, CTHBP, HEL-S-30, OIP3, PK3, PKM2, TCB, THBP1, p58
|
||
| Sequence |
MSKPHSEAGTAFIQTQQLHAAMADTFLEHMCRLDIDSPPITARNTGIICTIGPASRSVET
LKEMIKSGMNVARLNFSHGTHEYHAETIKNVRTATESFASDPILYRPVAVALDTKGPEIR TGLIKGSGTAEVELKKGATLKITLDNAYMEKCDENILWLDYKNICKVVEVGSKIYVDDGL ISLQVKQKGADFLVTEVENGGSLGSKKGVNLPGAAVDLPAVSEKDIQDLKFGVEQDVDMV FASFIRKASDVHEVRKVLGEKGKNIKIISKIENHEGVRRFDEILEASDGIMVARGDLGIE IPAEKVFLAQKMMIGRCNRAGKPVICATQMLESMIKKPRPTRAEGSDVANAVLDGADCIM LSGETAKGDYPLEAVRMQHLIAREAEAAIYHLQLFEELRRLAPITSDPTEATAVGAVEAS FKCCSGAIIVLTKSGRSAHQVARYRPRAPIIAVTRNPQTARQAHLYRGIFPVLCKDPVQE AWAEDVDLRVNFAMNVGKARGFFKKGDVVIVLTGWRPGSGFTNTMRVVPVP |
||
| Pathway Map | MAP LINK | ||
| T.C. Number | 1.E.61 | ||
| KEGG ID | hsa5315 | ||
| TTD ID | T65889 | ||
| Pfam | PF00224; PF02887; PF03328 | ||
| Pair Name | Isovitexin, Cisplatin | |||
| Phytochemical Name | Isovitexin | |||
| Anticancer drug Name | Cisplatin | |||
| Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
| Regulate Info | Down-regulation | Pyruvate kinase PKM | Expression | |
| Result | IVT not only inhibited cell proliferation and glucose metabolism via downregulating the expression of PKM2 to enhance the antitumor activity of DDP against lung cancer cells, and improved DDP-induced immunotoxicity in mice. It also presented a novel strategy to enhance the anti-tumor effect of platinum-based chemotherapy against NSCLC. | |||
| Pair Name | Scutellarin, Oxaliplatin | |||
| Phytochemical | Scutellarin | |||
| Drug | Oxaliplatin | |||
| Disease Info | [ICD-11: 2B91] | Colorectal cancer | Investigative | |
| Regulate Info | Down-regulation | Pyruvate kinase PKM | Activity | |
| Result | It was indicated that scutellarin resensitizes oxaliplatin-resistant CRC cells to oxaliplatin treatment through inhibition of PKM2. | |||
| Pair Name | Shikonin, Gefitinib | |||
| Phytochemical | Shikonin | |||
| Drug | Gefitinib | |||
| Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
| Regulate Info | Down-regulation | Pyruvate kinase PKM | Expression | |
| Result | These results provide a promising therapeutic approach for the treatment of wild-type EGFR non-small cell lung cancer. | |||
| Pair Name | Kaempferol, Fluorouracil | |||
| Phytochemical | Kaempferol | |||
| Drug | Fluorouracil | |||
| Disease Info | [ICD-11: 2B91] | Colorectal cancer | Investigative | |
| Regulate Info | Down-regulation | Pyruvate kinase PKM | Expression | |
| Result | Our data suggest that kaempferol may play an important role in overcoming resistance to 5-Fu therapy by regulating the miR-326-hnRNPA1/A2/PTBP1-PKM2 axis. | |||
| No. | Title | Href |
|---|---|---|
| 1 | Isovitexin potentiated the antitumor activity of cisplatin by inhibiting the glucose metabolism of lung cancer cells and reduced cisplatin-induced immunotoxicity in mice. Int Immunopharmacol. 2021 May;94:107357. doi: 10.1016/j.intimp.2020.107357. | Click |
| 2 | Scutellarin resensitizes oxaliplatin-resistant colorectal cancer cells to oxaliplatin treatment through inhibition of PKM2. Mol Ther Oncolytics. 2021 Mar 17;21:87-97. doi: 10.1016/j.omto.2021.03.010. | Click |
| 3 | Shikonin enhances sensitization of gefitinib against wild-type EGFR non-small cell lung cancer via inhibition PKM2/stat3/cyclinD1 signal pathway. Life Sci. 2018 Jul 1;204:71-77. doi: 10.1016/j.lfs.2018.05.012. | Click |
| 4 | Kaempferol Can Reverse the 5-Fu Resistance of Colorectal Cancer Cells by Inhibiting PKM2-Mediated Glycolysis. Int J Mol Sci. 2022 Mar 24;23(7):3544. doi: 10.3390/ijms23073544. | Click |
