| Name | Platelet endothelial cell adhesion molecule | ||
| UniProt ID | PECA1_HUMAN | ||
| Gene Name | PECAM1 | ||
| Gene ID | 5175 | ||
| Synonyms |
PECAM1, CD31, CD31/EndoCAM, GPIIA', PECA1, PECAM-1, endoCAM
|
||
| Sequence |
MQPRWAQGATMWLGVLLTLLLCSSLEGQENSFTINSVDMKSLPDWTVQNGKNLTLQCFAD
VSTTSHVKPQHQMLFYKDDVLFYNISSMKSTESYFIPEVRIYDSGTYKCTVIVNNKEKTT AEYQVLVEGVPSPRVTLDKKEAIQGGIVRVNCSVPEEKAPIHFTIEKLELNEKMVKLKRE KNSRDQNFVILEFPVEEQDRVLSFRCQARIISGIHMQTSESTKSELVTVTESFSTPKFHI SPTGMIMEGAQLHIKCTIQVTHLAQEFPEIIIQKDKAIVAHNRHGNKAVYSVMAMVEHSG NYTCKVESSRISKVSSIVVNITELFSKPELESSFTHLDQGERLNLSCSIPGAPPANFTIQ KEDTIVSQTQDFTKIASKSDSGTYICTAGIDKVVKKSNTVQIVVCEMLSQPRISYDAQFE VIKGQTIEVRCESISGTLPISYQLLKTSKVLENSTKNSNDPAVFKDNPTEDVEYQCVADN CHSHAKMLSEVLRVKVIAPVDEVQISILSSKVVESGEDIVLQCAVNEGSGPITYKFYREK EGKPFYQMTSNATQAFWTKQKASKEQEGEYYCTAFNRANHASSVPRSKILTVRVILAPWK KGLIAVVIIGVIIALLIIAAKCYFLRKAKAKQMPVEMSRPAVPLLNSNNEKMSDPNMEAN SHYGHNDDVRNHAMKPINDNKEPLNSDVQYTEVQVSSAESHKDLGKKDTETVYSEVRKAV PDAVESRYSRTEGSLDGT |
||
| Pathway Map | MAP LINK | ||
| KEGG ID | hsa5175 | ||
| TTD ID | T89056 | ||
| Pfam | PF00047; PF05790; PF07679; PF07686; PF08204; PF13895; PF13927; PF15807; PF16706; PF17736 | ||
| Pair Name | Honokiol, Celecoxib | |||
| Phytochemical Name | Honokiol | |||
| Anticancer drug Name | Celecoxib | |||
| Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
| Regulate Info | Down-regulation | Platelet endothelial cell adhesion molecule | Expression | |
| Result | The combined treatment with PV-CXB and PV-HNK showed synergistic effect both in vitro and in vivo | |||
| Pair Name | Artesunate, Sorafenib | |||
| Phytochemical | Artesunate | |||
| Drug | Sorafenib | |||
| Disease Info | [ICD-11: XH50P3] | Non‑hodgkin lymphoma | Investigative | |
| Regulate Info | Down-regulation | Platelet endothelial cell adhesion molecule | Expression | |
| Result | Artesunate synergistically promotes sorafenib‑induced apoptosis and ferroptosis in non‑Hodgkin lymphoma cells through inhibition of the STAT3 pathway | |||
| Pair Name | Beta-Elemene, Bevacizumab | |||
| Phytochemical | Beta-Elemene | |||
| Drug | Bevacizumab | |||
| Disease Info | [ICD-11: 2B90] | Colon cancer | Investigative | |
| Regulate Info | Down-regulation | Platelet endothelial cell adhesion molecule | Expression | |
| Result | Bevacizumab exerts a synergistic effect with β-elemene in suppressing the growth of tumors derived from HCT-116 cells, and the related mechanisms may include the inhibition of tumor cell proliferation and tumor angiogenesis and the promotion of tumor cell apoptosis. | |||
| Pair Name | Dihydroartemisinin, Capecitabine | |||
| Phytochemical | Dihydroartemisinin | |||
| Drug | Capecitabine | |||
| Disease Info | [ICD-11: 2B91] | Colorectal cancer | Investigative | |
| Regulate Info | Down-regulation | Platelet endothelial cell adhesion molecule | Expression | |
| Result | DHA in combination with Cap could be a novel therapeutic strategy for CRC with improved efficacy and reduced side effects. | |||
| Pair Name | Ginsenoside Rb1, Apatinib | |||
| Phytochemical | Ginsenoside Rb1 | |||
| Drug | Apatinib | |||
| Disease Info | [ICD-11: 2B6E] | Hypopharyngeal carcinoma | Investigative | |
| Regulate Info | Down-regulation | Platelet endothelial cell adhesion molecule | Expression | |
| Result | A combination of apatinib and G-Rb1 induced more tumor cell apoptosis and reduced cell proliferation than the individual drug treatment and promote antitumor immunity by enhancing immunomodulatory molecules. Thus, we believe that this study could serve as a valuable platform to assess the synergetic anticancer effects of the herbal as well as synthetic medicines. | |||
| Pair Name | Niacinamide, Gemcitabine | |||
| Phytochemical | Niacinamide | |||
| Drug | Gemcitabine | |||
| Disease Info | [ICD-11: 2C10] | Pancreatic cancer | Investigative | |
| Regulate Info | Up-regulation | Platelet endothelial cell adhesion molecule | Expression | |
| Result | This study highlights the potential of NAM+GEM as immunotherapy for advanced pancreatic cancer. | |||
| No. | Title | Href |
|---|---|---|
| 1 | Tuning mPEG-PLA/vitamin E-TPGS-based mixed micelles for combined celecoxib/honokiol therapy for breast cancer. Eur J Pharm Sci. 2020 Apr 15;146:105277. doi: 10.1016/j.ejps.2020.105277. | Click |
| 2 | Artesunate synergistically promotes sorafenib‑induced apoptosis and ferroptosis in non‑Hodgkin lymphoma cells through inhibition of the STAT3 pathway. Oncol Rep. 2023 Jul;50(1):147. doi: 10.3892/or.2023.8584. | Click |
| 3 | Synergistic effects of bevacizumab in combination with β-elemene on subcutaneous xenografts derived from HCT-116 human colon cancer cells. Transl Cancer Res. 2020 Feb;9(2):1001-1011. doi: 10.21037/tcr.2019.12.35. | Click |
| 4 | Dihydroartemisinin inhibits the development of colorectal cancer by GSK-3β/TCF7/MMP9 pathway and synergies with capecitabine. Cancer Lett. 2024 Feb 1;582:216596. doi: 10.1016/j.canlet.2023.216596. | Click |
| 5 | Apatinib and Ginsenoside-Rb1 Synergetically Control the Growth of Hypopharyngeal Carcinoma Cells. Dis Markers. 2022 Jan 13;2022:3833489. doi: 10.1155/2022/3833489. | Click |
| 6 | Nicotinamide combined with gemcitabine is an immunomodulatory therapy that restrains pancreatic cancer in mice. J Immunother Cancer. 2020 Nov;8(2):e001250. doi: 10.1136/jitc-2020-001250. | Click |
