| Name | Mixed lineage kinase domain-like protein | ||
| UniProt ID | MLKL_HUMAN | ||
| Gene Name | MLKL | ||
| Gene ID | 197259 | ||
| Synonyms |
MLKL, hMLKL
|
||
| Sequence |
MENLKHIITLGQVIHKRCEEMKYCKKQCRRLGHRVLGLIKPLEMLQDQGKRSVPSEKLTT
AMNRFKAALEEANGEIEKFSNRSNICRFLTASQDKILFKDVNRKLSDVWKELSLLLQVEQ RMPVSPISQGASWAQEDQQDADEDRRAFQMLRRDNEKIEASLRRLEINMKEIKETLRQYL PPKCMQEIPQEQIKEIKKEQLSGSPWILLRENEVSTLYKGEYHRAPVAIKVFKKLQAGSI AIVRQTFNKEIKTMKKFESPNILRIFGICIDETVTPPQFSIVMEYCELGTLRELLDREKD LTLGKRMVLVLGAARGLYRLHHSEAPELHGKIRSSNFLVTQGYQVKLAGFELRKTQTSMS LGTTREKTDRVKSTAYLSPQELEDVFYQYDVKSEIYSFGIVLWEIATGDIPFQGCNSEKI RKLVAVKRQQEPLGEDCPSELREIIDECRAHDPSVRPSVDEILKKLSTFSK |
||
| Pathway Map | MAP LINK | ||
| T.C. Number | 1.A.105.1.1 | ||
| KEGG ID | hsa197259 | ||
| Pfam | PF00069; PF07714; PF18922 | ||
| Pair Name | Berbamine, Cisplatin | |||
| Phytochemical | Berbamine | |||
| Drug | Cisplatin | |||
| Disease Info | [ICD-11: 2B91] | Colorectal cancer | Investigative | |
| Regulate Info | Up-regulation | Mixed lineage kinase domain-like protein | Phosphorylation | |
| Result | This study proposed that the combination therapy of BBR and DDP markedly enhanced more ovarian cancer cell death by inducing apoptosis and necroptosis, which may improve the anticancer effect of chemotherapy drugs. The apoptosis involved the caspase-dependent pathway, while the necroptosis involved the activation of the RIPK3-MLKL pathway. We hope our findings might provide a new insight for the potential of BBR as a therapeutic agent in the treatment of ovarian cancer. | |||
| Pair Name | Curcumin, Binimetinib | |||
| Phytochemical | Curcumin | |||
| Drug | Binimetinib | |||
| Disease Info | [ICD-11: 2C30] | Melanoma | Investigative | |
| Regulate Info | Up-regulation | Mixed lineage kinase domain-like protein | Phosphorylation | |
| Result | Our data demonstrates that curcumin exerts significant synergistic anticancer effects on MM cells by inducing ROS and necroptosis when combined with binimetinib. Therefore, a strategy of adding curcumin to conventional anticancer agents holds promise for treating MM. | |||
| Pair Name | Delta-Tocotrienol, Docetaxel | |||
| Phytochemical | Delta-Tocotrienol | |||
| Drug | Docetaxel | |||
| Disease Info | [ICD-11: 2C82] | Prostate cancer | Investigative | |
| Regulate Info | Up-regulation | Mixed lineage kinase domain-like protein | Phosphorylation | |
| Result | The ability of δ-TT to induce necroptotic cell death may represent a promising therapeutical approach to overcome DTX chemoresistance in PCa. | |||
| Pair Name | Piperlongumine, Cisplatin | |||
| Phytochemical | Piperlongumine | |||
| Drug | Cisplatin | |||
| Disease Info | [ICD-11: 2C94] | Bladder cancer | Investigative | |
| Regulate Info | Up-regulation | Mixed lineage kinase domain-like protein | Phosphorylation | |
| Result | Our results demonstrated the role of RIPK1 in cisplatin-resistant cells and the sensitization effect of the natural drug PL on bladder cancer. These may provide a new treatment strategy for overcoming cisplatin resistance in bladder cancer. | |||
| Pair Name | Zeylenone, Cisplatin | |||
| Phytochemical | Zeylenone | |||
| Drug | Cisplatin | |||
| Disease Info | [ICD-11: 2B51] | Osteosarcoma | Investigative | |
| Regulate Info | Up-regulation | Mixed lineage kinase domain-like protein | Expression | |
| Result | Zeylenone synergizes with cisplatin in osteosarcoma by enhancing DNA damage, apoptosis, and necrosis via the Hsp90/AKT/GSK3β and Fanconi anaemia pathway | |||
| No. | Title | Href |
|---|---|---|
| 1 | Berberine in combination with cisplatin induces necroptosis and apoptosis in ovarian cancer cells. Biol Res. 2019 Jul 18;52(1):37. doi: 10.1186/s40659-019-0243-6. | Click |
| 2 | Curcumin Enhances the Anticancer Effects of Binimetinib on Melanoma Cells by Inducing Mitochondrial Dysfunction and Cell Apoptosis with Necroptosis. Ann Dermatol. 2023 Jun;35(3):217-228. doi: 10.5021/ad.22.200. | Click |
| 3 | Necroptosis Induced by Delta-Tocotrienol Overcomes Docetaxel Chemoresistance in Prostate Cancer Cells. Int J Mol Sci. 2023 Mar 3;24(5):4923. doi: 10.3390/ijms24054923. | Click |
| 4 | Piperlongumine increases the sensitivity of bladder cancer to cisplatin by mitochondrial ROS. J Clin Lab Anal. 2022 Jun;36(6):e24452. doi: 10.1002/jcla.24452. | Click |
| 5 | Zeylenone synergizes with cisplatin in osteosarcoma by enhancing DNA damage, apoptosis, and necrosis via the Hsp90/AKT/GSK3β and Fanconi anaemia pathway. Phytother Res. 2021 Oct;35(10):5899-5918. doi: 10.1002/ptr.7299 | Click |
