Name | Dual specificity mitogen-activated protein kinase kinase 7 | ||
UniProt ID | MP2K7_HUMAN | ||
Gene Name | MAP2K7 | ||
Gene ID | 5609 | ||
Synonyms |
MAP2K7, JNKK2, MAPKK7, MEK, MEK_7, MKK7, PRKMK7, SAPKK-4, SAPKK4
|
||
Sequence |
MAASSLEQKLSRLEAKLKQENREARRRIDLNLDISPQRPRPTLQLPLANDGGSRSPSSES
SPQHPTPPARPRHMLGLPSTLFTPRSMESIEIDQKLQEIMKQTGYLTIGGQRYQAEINDL ENLGEMGSGTCGQVWKMRFRKTGHVIAVKQMRRSGNKEENKRILMDLDVVLKSHDCPYIV QCFGTFITNTDVFIAMELMGTCAEKLKKRMQGPIPERILGKMTVAIVKALYYLKEKHGVI HRDVKPSNILLDERGQIKLCDFGISGRLVDSKAKTRSAGCAAYMAPERIDPPDPTKPDYD IRADVWSLGISLVELATGQFPYKNCKTDFEVLTKVLQEEPPLLPGHMGFSGDFQSFVKDC LTKDHRKRPKYNKLLEHSFIKRYETLEVDVASWFKDVMAKTESPRTSGVLSQPHLPFFR |
||
Pathway Map | MAP LINK | ||
KEGG ID | hsa5609 | ||
TTD ID | T53159 | ||
Pfam | PF00069; PF01163; PF01636; PF03109; PF07387; PF07714; PF12330; PF14531 |
Pair Name | Narirutin, Cisplatin | |||
Phytochemical Name | Narirutin | |||
Anticancer drug Name | Cisplatin | |||
Disease Info | [ICD-11: 2C25.Z] | Lung cancer | Investigative | |
Regulate Info | Down-regulation | Dual specificity mitogen-activated protein kinase kinase 7 | Phosphorylation | |
Result | Based on the significant anticancer effect and high biosafety, naringin has great potential as a functional food in the adjuvant treatment of lung cancer. |
Pair Name | Biochanin A, SB590885 | |||
Phytochemical Name | Biochanin A | |||
Anticancer drug Name | SB590885 | |||
Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
Regulate Info | Down-regulation | Dual specificity mitogen-activated protein kinase kinase 7 | Phosphorylation | |
Result | The results identify an effective combination therapy for the most aggressive form of HCC and provide the possibility of therapeutic improvement for patients with advanced HCC. |
Pair Name | Evodiamine, Doxorubicin | |||
Phytochemical | Evodiamine | |||
Drug | Doxorubicin | |||
Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
Regulate Info | Down-regulation | Dual specificity mitogen-activated protein kinase kinase 7 | Phosphorylation | |
Result | Our results indicated that EVO enhanced the apoptotic action of DOX by inhibiting the Ras/MEK/ERK cascade and the expression of IAPs without inhibiting the expression and activity of P-glycoprotein (P-gp). Taken together, our data indicate that EVO, a natural product, may be useful applied alone or in combination with DOX for the treatment of resistant breast cancer. |
Pair Name | Lycorine, Bortezomib | |||
Phytochemical | Lycorine | |||
Drug | Bortezomib | |||
Disease Info | [ICD-11: 2A83.1] | Multiple myeloma | Investigative | |
Regulate Info | Down-regulation | Dual specificity mitogen-activated protein kinase kinase 7 | Phosphorylation | |
Result | We observed higher HMGB1 expression in bortezomib resistant cells and the combination of bortezomib plus lycorine was highly efficient in vitro and in vivo myeloma models as well as in re-sensitizing resistant cells to bortezomib. These observations indicate lycorine as an effective autophagy inhibitor and reveal that lycorine alone or in combination with bortezomib is a potential therapeutic strategy. |
Pair Name | Oleanolic Acid, Gemcitabine | |||
Phytochemical | Oleanolic Acid | |||
Drug | Gemcitabine | |||
Disease Info | [ICD-11: 2C10.Z] | Pancreatic cancer | Investigative | |
Regulate Info | Down-regulation | Dual specificity mitogen-activated protein kinase kinase 7 | Expression | |
Result | We found an interesting finding that the 73-03 in combination with GCB can improve GCB efficacy and decrease PCa resistance, which induced apoptosis and mitochondrial damage through epigenetic inhibition of SPINK1 transcription by miR-421 up-regulation. This was the first study that used OA derivatives on GCB-resistant PCa cells, so this combined strategy warrants further investigation. |
Pair Name | Chicoric acid, TNF-related apoptosis inducing ligand | |||
Phytochemical | Chicoric acid | |||
Drug | TNF-related apoptosis inducing ligand | |||
Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
Regulate Info | Down-regulation | Dual specificity mitogen-activated protein kinase kinase 7 | Expression | |
Result | Our results suggest that TO plays an important role in TRAIL-induced apoptosis, and further functional studies are warranted to confirm the importance of TO as a novel TRAIL sensitizer for cancer therapy. |
Pair Name | Magnolin, B-RAF Inhibitors | |||
Phytochemical | Magnolin | |||
Drug | B-RAF Inhibitors | |||
Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
Regulate Info | Down-regulation | Dual specificity mitogen-activated protein kinase kinase 7 | Phosphorylation | |
Result | Synergistic activity of magnolin combined with B-RAF inhibitor SB590885 in hepatocellular carcinoma cells via targeting PI3K-AKT/mTOR and ERK MAPK pathway |
Pair Name | All-trans retinoic acid, Midostaurin | |||
Phytochemical | All-trans-retinoic acid | |||
Drug | Midostaurin | |||
Disease Info | [ICD-11: 2A60.Z] | Acute myeloid leukemia | Investigative | |
Regulate Info | Up-regulation | Dual specificity mitogen-activated protein kinase kinase 7 | Phosphorylation | |
Result | Combination of midostaurin and ATRA exerts dose-dependent dual effects on acute myeloid leukemia cells with wild type FLT3 |
Pair Name | Sulforaphene, Photodynamic therapy | |||
Phytochemical | Sulforaphene | |||
Drug | Photodynamic therapy | |||
Disease Info | [ICD-11: 2D10.Z] | Thyroid cancer | Investigative | |
Regulate Info | Down-regulation | Dual specificity mitogen-activated protein kinase kinase 7 | Phosphorylation | |
Result | Our work designates sulforaphene as a unique natural enhancer of efficacy with PDT against anaplastic thyroid cancer. |
No. | Title | Href |
---|---|---|
1 | Molecular mechanism of ion channel protein TMEM16A regulated by natural product of narirutin for lung cancer adjuvant treatment. Int J Biol Macromol. 2022 Dec 31;223(Pt A):1145-1157. doi: 10.1016/j.ijbiomac.2022.11.123. | Click |
2 | The combination of Biochanin A and SB590885 potentiates the inhibition of tumour progression in hepatocellular carcinoma. Cancer Cell Int. 2020 Aug 5;20:371. doi: 10.1186/s12935-020-01463-w. | Click |
3 | Evodiamine synergizes with doxorubicin in the treatment of chemoresistant human breast cancer without inhibiting P-glycoprotein. PLoS One. 2014 May 15;9(5):e97512. doi: 10.1371/journal.pone.0097512. | Click |
4 | Lycorine Downregulates HMGB1 to Inhibit Autophagy and Enhances Bortezomib Activity in Multiple Myeloma. Theranostics. 2016 Sep 24;6(12):2209-2224. doi: 10.7150/thno.15584. | Click |
5 | Enhancement of gemcitabine efficacy by K73-03 via epigenetically regulation of miR-421/SPINK1 in gemcitabine resistant pancreatic cancer cells. Phytomedicine. 2021 Oct;91:153711. doi: 10.1016/j.phymed.2021.153711. | Click |
6 | Novel TRAIL sensitizer Taraxacum officinale F.H. Wigg enhances TRAIL-induced apoptosis in Huh7 cells. Mol Carcinog. 2016;55(4):387-396. doi:10.1002/mc.22288 | Click |
7 | Synergistic activity of magnolin combined with B-RAF inhibitor SB590885 in hepatocellular carcinoma cells via targeting PI3K-AKT/mTOR and ERK MAPK pathway. Am J Transl Res. 2019 Jun 15;11(6):3816-3824. | Click |
8 | Combination of midostaurin and ATRA exerts dose-dependent dual effects on acute myeloid leukemia cells with wild type FLT3. BMC Cancer. 2022 Jul 9;22(1):749. doi: 10.1186/s12885-022-09828-2. | Click |
9 | Sulforaphene Enhances The Efficacy of Photodynamic Therapy In Anaplastic Thyroid Cancer Through Ras/RAF/MEK/ERK Pathway Suppression. J Photochem Photobiol B. 2018 Feb;179:46-53. doi: 10.1016/j.jphotobiol.2017.12.013. | Click |