Name | Phospholipid hydroperoxide glutathione peroxidase GPX4 | ||
UniProt ID | GPX4_HUMAN | ||
Gene Name | GPX4 | ||
Gene ID | 2879 | ||
Synonyms |
GPX4, GPx-4, GSHPx-4, MCSP, PHGPx, SMDS, snGPx, snPHGPx
|
||
Sequence |
MSLGRLCRLLKPALLCGALAAPGLAGTMCASRDDWRCARSMHEFSAKDIDGHMVNLDKYR
GFVCIVTNVASQUGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFA AGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKRY GPMEEPLVIEKDLPHYF |
||
Pathway Map | MAP LINK | ||
KEGG ID | hsa2879 | ||
Pfam | PF00255; PF00578 |
Pair Name | Baicalin, Fluorouracil | |||
Phytochemical | Baicalin | |||
Drug | Fluorouracil | |||
Disease Info | [ICD-11: 2B72.Z] | Gastric cancer | Investigative | |
Regulate Info | Down-regulation | Phospholipid hydroperoxide glutathione peroxidase GPX4 | Expression | |
Result | Baicalin inhibits GC and enhances 5-Fu by promoting ROS-related ferroptosis in GC. |
Pair Name | Triptolide, Doxorubicin | |||
Phytochemical | Triptolide | |||
Drug | Doxorubicin | |||
Disease Info | [ICD-11: 2B33.4] | Leukemia | Investigative | |
Regulate Info | Down-regulation | Phospholipid hydroperoxide glutathione peroxidase GPX4 | Expression | |
Result | The present study indicated that Nrf2 served a critical role in leukemia cell resistance to DOX and triptolide‑induced ferroptosis and suggested a potential strategy of combination therapy using triptolide and DOX in leukemia treatment. |
Pair Name | Dihydroartemisinin, Sorafenib | |||
Phytochemical | Dihydroartemisinin | |||
Drug | Sorafenib | |||
Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
Regulate Info | Down-regulation | Phospholipid hydroperoxide glutathione peroxidase GPX4 | Expression | |
Result | DHA and Sora had the same mechanism, and the combined application of them could have a synergistic anti-tumor effect by inducing ferroptosis and inhibiting energy metabolism in HepG2 cells. |
Pair Name | Artesunate, Sorafenib | |||
Phytochemical | Artesunate | |||
Drug | Sorafenib | |||
Disease Info | [ICD-11: XH50P3] | Non‑hodgkin lymphoma | Investigative | |
Regulate Info | Down-regulation | Phospholipid hydroperoxide glutathione peroxidase GPX4 | Expression | |
Result | Artesunate synergistically promotes sorafenib‑induced apoptosis and ferroptosis in non‑Hodgkin lymphoma cells through inhibition of the STAT3 pathway |
Pair Name | Luteolin, Erastin | |||
Phytochemical | Luteolin | |||
Drug | Erastin | |||
Disease Info | [ICD-11: 2B90.Z] | Colon cancer | Investigative | |
Regulate Info | Down-regulation | Phospholipid hydroperoxide glutathione peroxidase GPX4 | Expression | |
Result | These results clearly demonstrated that luteolin acts synergistically with erastin and renders colon cancer cells vulnerable to ferroptosis through the HIC1-mediated inhibition of GPX4 expression, which may act as a promising therapeutic strategy. |
Pair Name | Tiliroside, Sorafenib | |||
Phytochemical | Tiliroside | |||
Drug | Sorafenib | |||
Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
Regulate Info | Down-regulation | Phospholipid hydroperoxide glutathione peroxidase GPX4 | Expression | |
Result | Our findings imply that tiliroside is a potent TBK1 inhibitor and a candidate natural anti-cancer product that could function as a sensitizer of sorafenib in HCC treatment by targeting TBK1 to induce ferroptosis. |
Pair Name | Zerumbone, Gefitinib | |||
Phytochemical | Zerumbone | |||
Drug | Gefitinib | |||
Disease Info | [ICD-11: 2C25.Z] | Lung cancer | Investigative | |
Regulate Info | Down-regulation | Phospholipid hydroperoxide glutathione peroxidase GPX4 | Expression | |
Result | Our study suggested that zerumbone combined with gefitinib could effectively inhibit lung cancer for multi-model therapies, including the inhibition of tumor growth, angiogenesis, induce cell apoptosis, and ferroptosis. |
Pair Name | Beta-Elemene, Cetuximab | |||
Phytochemical | Beta-Elemene | |||
Drug | Cetuximab | |||
Disease Info | [ICD-11: 2B91.Z] | Colorectal cancer | Investigative | |
Regulate Info | Down-regulation | Phospholipid hydroperoxide glutathione peroxidase GPX4 | Expression | |
Result | natural product β-elemene is a new ferroptosis inducer and combinative treatment of β-elemene and cetuximab is sensitive to KRAS mutant CRC cells by inducing ferroptosis and inhibiting EMT, which will hopefully provide a prospective strategy for CRC patients with RAS mutations. |
Pair Name | Escin, Cisplatin | |||
Phytochemical | Escin | |||
Drug | Cisplatin | |||
Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
Regulate Info | Down-regulation | Phospholipid hydroperoxide glutathione peroxidase GPX4 | Expression | |
Result | Role of Escin in breast cancer therapy: potential mechanism for inducing ferroptosis and synergistic antitumor activity with cisplatin |
Pair Name | Shikonin, Cisplatin | |||
Phytochemical | Shikonin | |||
Drug | Cisplatin | |||
Disease Info | [ICD-11: 2C73] | Ovarian cancer | Investigative | |
Regulate Info | Down-regulation | Phospholipid hydroperoxide glutathione peroxidase GPX4 | Expression | |
Result | Shikonin and cisplatin synergistically overcome cisplatin resistance of ovarian cancer by inducing ferroptosis via upregulation of HMOX1 to promote Fe2+ accumulation |
Pair Name | 2,3,5,6-Tetramethylpyrazine, Cisplatin | |||
Phytochemical | 2,3,5,6-Tetramethylpyrazine | |||
Drug | Cisplatin | |||
Disease Info | [ICD-11: 2C10.Z] | Pancreatic cancer | Investigative | |
Regulate Info | Down-regulation | Phospholipid hydroperoxide glutathione peroxidase GPX4 | Expression | |
Result | A series of ligustrazine-derived chalcones-modified platinum(IV) complexes were synthesized and evaluated for their anti-proliferative potency and generated an optimal platinum(IV) complex 16a. The above-described results indicated that 16a obtained different anti-cancer mechanisms of CDDP, which could initiate mitochondria-dependent apoptosis and xCT-GPX4 axial-mediated ferroptosis in PANC-1/CDDP cells. |
No. | Title | Href |
---|---|---|
1 | Baicalin enhances the efficacy of 5-Fluorouracil in gastric cancer by promoting ROS-mediated ferroptosis. Biomed Pharmacother. 2023 Aug;164:114986. doi: 10.1016/j.biopha.2023.114986. | Click |
2 | Triptolide promotes ferroptosis by suppressing Nrf2 to overcome leukemia cell resistance to doxorubicin. Mol Med Rep. 2023 Jan;27(1):17. doi: 10.3892/mmr.2022.12904. | Click |
3 | Dihydroartemisinin enhances the inhibitory effect of sorafenib on HepG2 cells by inducing ferroptosis and inhibiting energy metabolism. J Pharmacol Sci. 2022 Jan;148(1):73-85. doi: 10.1016/j.jphs.2021.09.008. | Click |
4 | Artesunate synergistically promotes sorafenib‑induced apoptosis and ferroptosis in non‑Hodgkin lymphoma cells through inhibition of the STAT3 pathway. Oncol Rep. 2023 Jul;50(1):147. doi: 10.3892/or.2023.8584. | Click |
5 | Luteolin exhibits synergistic therapeutic efficacy with erastin to induce ferroptosis in colon cancer cells through the HIC1-mediated inhibition of GPX4 expression. Free Radic Biol Med. 2023 Nov 1;208:530-544. doi: 10.1016/j.freeradbiomed.2023.09.014. | Click |
6 | Tiliroside targets TBK1 to induce ferroptosis and sensitize hepatocellular carcinoma to sorafenib. Phytomedicine. 2023 Mar;111:154668. doi: 10.1016/j.phymed.2023.154668. | Click |
7 | Zerumbone combined with gefitinib alleviates lung cancer cell growth through the AKT/STAT3/SLC7A11 axis. Neoplasma. 2023 Feb;70(1):58-70. doi: 10.4149/neo_2022_220418N423. | Click |
8 | Combinative treatment of β-elemene and cetuximab is sensitive to KRAS mutant colorectal cancer cells by inducing ferroptosis and inhibiting epithelial-mesenchymal transformation. Theranostics. 2020;10(11):5107-5119. Published 2020 Apr 6. doi:10.7150/thno.44705 | Click |
9 | Role of Escin in breast cancer therapy: potential mechanism for inducing ferroptosis and synergistic antitumor activity with cisplatin. Apoptosis. 2023 Aug;28(7-8):1154-1167. doi: 10.1007/s10495-023-01849-x. | Click |
10 | Shikonin and cisplatin synergistically overcome cisplatin resistance of ovarian cancer by inducing ferroptosis via upregulation of HMOX1 to promote Fe2+ accumulation. Phytomedicine. 2023 Apr;112:154701. doi: 10.1016/j.phymed.2023.154701. | Click |
11 | Ligustrazine-Derived Chalcones-Modified Platinum(IV) Complexes Intervene in Cisplatin Resistance in Pancreatic Cancer through Ferroptosis and Apoptosis. J Med Chem. 2023 Oct 12;66(19):13587-13606. doi: 10.1021/acs.jmedchem.3c00922. | Click |