TOP
Nav Bar
  1. General Info
  2. Effects Info
  3. Reference
Molecular Details
01. General Information
Name Phospholipid hydroperoxide glutathione peroxidase GPX4
UniProt ID GPX4_HUMAN
Gene Name GPX4
Gene ID 2879
Synonyms
GPX4, GPx-4, GSHPx-4, MCSP, PHGPx, SMDS, snGPx, snPHGPx
Sequence
MSLGRLCRLLKPALLCGALAAPGLAGTMCASRDDWRCARSMHEFSAKDIDGHMVNLDKYR
GFVCIVTNVASQUGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFA
AGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKRY
GPMEEPLVIEKDLPHYF
Pathway Map MAP LINK
KEGG ID hsa2879
Pfam PF00255; PF00578
02. Combinatorial Therapeutic Effect(s)
Synergistic Effect
Hide/Show
Enhancing Drug Efficacy
Hide/Show
Combination Pair ID: 71
Pair Name Baicalin, Fluorouracil
Phytochemical Baicalin
Drug Fluorouracil
Disease Info [ICD-11: 2B72.Z] Gastric cancer Investigative
Regulate Info Down-regulation Phospholipid hydroperoxide glutathione peroxidase GPX4 Expression
Result Baicalin inhibits GC and enhances 5-Fu by promoting ROS-related ferroptosis in GC.
Combination Pair ID: 154
Pair Name Triptolide, Doxorubicin
Phytochemical Triptolide
Drug Doxorubicin
Disease Info [ICD-11: 2B33.4] Leukemia Investigative
Regulate Info Down-regulation Phospholipid hydroperoxide glutathione peroxidase GPX4 Expression
Result The present study indicated that Nrf2 served a critical role in leukemia cell resistance to DOX and triptolide‑induced ferroptosis and suggested a potential strategy of combination therapy using triptolide and DOX in leukemia treatment.
Combination Pair ID: 165
Pair Name Dihydroartemisinin, Sorafenib
Phytochemical Dihydroartemisinin
Drug Sorafenib
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Down-regulation Phospholipid hydroperoxide glutathione peroxidase GPX4 Expression
Result DHA and Sora had the same mechanism, and the combined application of them could have a synergistic anti-tumor effect by inducing ferroptosis and inhibiting energy metabolism in HepG2 cells.
Combination Pair ID: 1006
Pair Name Artesunate, Sorafenib
Phytochemical Artesunate
Drug Sorafenib
Disease Info [ICD-11: XH50P3] Non‑hodgkin lymphoma Investigative
Regulate Info Down-regulation Phospholipid hydroperoxide glutathione peroxidase GPX4 Expression
Result Artesunate synergistically promotes sorafenib‑induced apoptosis and ferroptosis in non‑Hodgkin lymphoma cells through inhibition of the STAT3 pathway
Combination Pair ID: 837
Pair Name Luteolin, Erastin
Phytochemical Luteolin
Drug Erastin
Disease Info [ICD-11: 2B90.Z] Colon cancer Investigative
Regulate Info Down-regulation Phospholipid hydroperoxide glutathione peroxidase GPX4 Expression
Result These results clearly demonstrated that luteolin acts synergistically with erastin and renders colon cancer cells vulnerable to ferroptosis through the HIC1-mediated inhibition of GPX4 expression, which may act as a promising therapeutic strategy.
Combination Pair ID: 483
Pair Name Tiliroside, Sorafenib
Phytochemical Tiliroside
Drug Sorafenib
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Down-regulation Phospholipid hydroperoxide glutathione peroxidase GPX4 Expression
Result Our findings imply that tiliroside is a potent TBK1 inhibitor and a candidate natural anti-cancer product that could function as a sensitizer of sorafenib in HCC treatment by targeting TBK1 to induce ferroptosis.
Combination Pair ID: 918
Pair Name Zerumbone, Gefitinib
Phytochemical Zerumbone
Drug Gefitinib
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Down-regulation Phospholipid hydroperoxide glutathione peroxidase GPX4 Expression
Result Our study suggested that zerumbone combined with gefitinib could effectively inhibit lung cancer for multi-model therapies, including the inhibition of tumor growth, angiogenesis, induce cell apoptosis, and ferroptosis.
Combination Pair ID: 585
Pair Name Beta-Elemene, Cetuximab
Phytochemical Beta-Elemene
Drug Cetuximab
Disease Info [ICD-11: 2B91.Z] Colorectal cancer Investigative
Regulate Info Down-regulation Phospholipid hydroperoxide glutathione peroxidase GPX4 Expression
Result natural product β-elemene is a new ferroptosis inducer and combinative treatment of β-elemene and cetuximab is sensitive to KRAS mutant CRC cells by inducing ferroptosis and inhibiting EMT, which will hopefully provide a prospective strategy for CRC patients with RAS mutations.
Combination Pair ID: 942
Pair Name Escin, Cisplatin
Phytochemical Escin
Drug Cisplatin
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Down-regulation Phospholipid hydroperoxide glutathione peroxidase GPX4 Expression
Result Role of Escin in breast cancer therapy: potential mechanism for inducing ferroptosis and synergistic antitumor activity with cisplatin
Reversing Drug Resistance
Hide/Show
Combination Pair ID: 283
Pair Name Shikonin, Cisplatin
Phytochemical Shikonin
Drug Cisplatin
Disease Info [ICD-11: 2C73] Ovarian cancer Investigative
Regulate Info Down-regulation Phospholipid hydroperoxide glutathione peroxidase GPX4 Expression
Result Shikonin and cisplatin synergistically overcome cisplatin resistance of ovarian cancer by inducing ferroptosis via upregulation of HMOX1 to promote Fe2+ accumulation
Combination Pair ID: 917
Pair Name 2,3,5,6-Tetramethylpyrazine, Cisplatin
Phytochemical 2,3,5,6-Tetramethylpyrazine
Drug Cisplatin
Disease Info [ICD-11: 2C10.Z] Pancreatic cancer Investigative
Regulate Info Down-regulation Phospholipid hydroperoxide glutathione peroxidase GPX4 Expression
Result A series of ligustrazine-derived chalcones-modified platinum(IV) complexes were synthesized and evaluated for their anti-proliferative potency and generated an optimal platinum(IV) complex 16a. The above-described results indicated that 16a obtained different anti-cancer mechanisms of CDDP, which could initiate mitochondria-dependent apoptosis and xCT-GPX4 axial-mediated ferroptosis in PANC-1/CDDP cells.
03. Reference
No. Title Href
1 Baicalin enhances the efficacy of 5-Fluorouracil in gastric cancer by promoting ROS-mediated ferroptosis. Biomed Pharmacother. 2023 Aug;164:114986. doi: 10.1016/j.biopha.2023.114986. Click
2 Triptolide promotes ferroptosis by suppressing Nrf2 to overcome leukemia cell resistance to doxorubicin. Mol Med Rep. 2023 Jan;27(1):17. doi: 10.3892/mmr.2022.12904. Click
3 Dihydroartemisinin enhances the inhibitory effect of sorafenib on HepG2 cells by inducing ferroptosis and inhibiting energy metabolism. J Pharmacol Sci. 2022 Jan;148(1):73-85. doi: 10.1016/j.jphs.2021.09.008. Click
4 Artesunate synergistically promotes sorafenib‑induced apoptosis and ferroptosis in non‑Hodgkin lymphoma cells through inhibition of the STAT3 pathway. Oncol Rep. 2023 Jul;50(1):147. doi: 10.3892/or.2023.8584. Click
5 Luteolin exhibits synergistic therapeutic efficacy with erastin to induce ferroptosis in colon cancer cells through the HIC1-mediated inhibition of GPX4 expression. Free Radic Biol Med. 2023 Nov 1;208:530-544. doi: 10.1016/j.freeradbiomed.2023.09.014. Click
6 Tiliroside targets TBK1 to induce ferroptosis and sensitize hepatocellular carcinoma to sorafenib. Phytomedicine. 2023 Mar;111:154668. doi: 10.1016/j.phymed.2023.154668. Click
7 Zerumbone combined with gefitinib alleviates lung cancer cell growth through the AKT/STAT3/SLC7A11 axis. Neoplasma. 2023 Feb;70(1):58-70. doi: 10.4149/neo_2022_220418N423. Click
8 Combinative treatment of β-elemene and cetuximab is sensitive to KRAS mutant colorectal cancer cells by inducing ferroptosis and inhibiting epithelial-mesenchymal transformation. Theranostics. 2020;10(11):5107-5119. Published 2020 Apr 6. doi:10.7150/thno.44705 Click
9 Role of Escin in breast cancer therapy: potential mechanism for inducing ferroptosis and synergistic antitumor activity with cisplatin. Apoptosis. 2023 Aug;28(7-8):1154-1167. doi: 10.1007/s10495-023-01849-x. Click
10 Shikonin and cisplatin synergistically overcome cisplatin resistance of ovarian cancer by inducing ferroptosis via upregulation of HMOX1 to promote Fe2+ accumulation. Phytomedicine. 2023 Apr;112:154701. doi: 10.1016/j.phymed.2023.154701. Click
11 Ligustrazine-Derived Chalcones-Modified Platinum(IV) Complexes Intervene in Cisplatin Resistance in Pancreatic Cancer through Ferroptosis and Apoptosis. J Med Chem. 2023 Oct 12;66(19):13587-13606. doi: 10.1021/acs.jmedchem.3c00922. Click
It has been 595908 visits since 2024.08
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang
TOP