| Name | Forkhead box protein P3 | ||
| UniProt ID | FOXP3_HUMAN | ||
| Gene Name | FOXP3 | ||
| Gene ID | 50943 | ||
| Synonyms |
FOXP3, AIID, DIETER, IPEX, JM2, PIDX, XPID
|
||
| Sequence |
MPNPRPGKPSAPSLALGPSPGASPSWRAAPKASDLLGARGPGGTFQGRDLRGGAHASSSS
LNPMPPSQLQLPTLPLVMVAPSGARLGPLPHLQALLQDRPHFMHQLSTVDAHARTPVLQV HPLESPAMISLTPPTTATGVFSLKARPGLPPGINVASLEWVSREPALLCTFPNPSAPRKD STLSAVPQSSYPLLANGVCKWPGCEKVFEEPEDFLKHCQADHLLDEKGRAQCLLQREMVQ SLEQQLVLEKEKLSAMQAHLAGKMALTKASSVASSDKGSCCIVAAGSQGPVVPAWSGPRE APDSLFAVRRHLWGSHGNSTFPEFLHNMDYFKFHNMRPPFTYATLIRWAILEAPEKQRTL NEIYHWFTRMFAFFRNHPATWKNAIRHNLSLHKCFVRVESEKGAVWTVDELEFRKKRSQR PSRCSNPTPGP |
||
| Pathway Map | MAP LINK | ||
| KEGG ID | hsa50943 | ||
| TTD ID | T36958 | ||
| Pfam | PF00250; PF16159; PF21816 | ||
| Pair Name | Honokiol, Celecoxib | |||
| Phytochemical Name | Honokiol | |||
| Anticancer drug Name | Celecoxib | |||
| Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
| Regulate Info | Down-regulation | Forkhead box protein P3 | Expression | |
| Result | The combined treatment with PV-CXB and PV-HNK showed synergistic effect both in vitro and in vivo | |||
| Pair Name | Dendrobine, Cisplatin | |||
| Phytochemical | Dendrobine | |||
| Drug | Cisplatin | |||
| Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
| Regulate Info | Down-regulation | Forkhead box protein P3 | Expression | |
| Result | Synergism Effect of Dendrobine on Cisplatin in Treatment of H1299 by Modulating the Balance of Treg/Th17 | |||
| Pair Name | Periplocin, TNF-related apoptosis inducing ligand | |||
| Phytochemical | Periplocin | |||
| Drug | TNF-related apoptosis inducing ligand | |||
| Disease Info | [ICD-11: 2B70.1] | Esophageal squamous cell carcinoma | Investigative | |
| Regulate Info | Down-regulation | Forkhead box protein P3 | Activity | |
| Result | Our data suggest that CPP and TRAIL could be further explored as potential therapeutic approach for esophageal cancer. | |||
| Pair Name | Sinapine, Doxorubicin | |||
| Phytochemical | Sinapine | |||
| Drug | Doxorubicin | |||
| Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
| Regulate Info | Down-regulation | Forkhead box protein P3 | Expression | |
| Result | Our findings indicated that sinapine played an important role in the downregulation of MDR1 expression through suppression of fibroblast growth factor receptor (FGFR)4/FRS2α-ERK1/2 mediated NF-κB activation in MCF-7/dox cancer cells. | |||
| No. | Title | Href |
|---|---|---|
| 1 | Tuning mPEG-PLA/vitamin E-TPGS-based mixed micelles for combined celecoxib/honokiol therapy for breast cancer. Eur J Pharm Sci. 2020 Apr 15;146:105277. doi: 10.1016/j.ejps.2020.105277. | Click |
| 2 | Synergism Effect of Dendrobine on Cisplatin in Treatment of H1299 by Modulating the Balance of Treg/Th17. Anticancer Agents Med Chem. 2023;23(1):105-112. doi: 10.2174/1871520622666220520093837. | Click |
| 3 | Combination of the natural compound Periplocin and TRAIL induce esophageal squamous cell carcinoma apoptosis in vitro and in vivo: Implication in anticancer therapy. J Exp Clin Cancer Res. 2019 Dec 21;38(1):501. doi: 10.1186/s13046-019-1498-z. | Click |
| 4 | Sinapine reverses multi-drug resistance in MCF-7/dox cancer cells by downregulating FGFR4/FRS2α-ERK1/2 pathway-mediated NF-κB activation. Phytomedicine. 2016 Mar 15;23(3):267-73. doi: 10.1016/j.phymed.2015.12.017. | Click |
