
| Name | Dynamin-1-like protein | ||
| UniProt ID | DNM1L_HUMAN | ||
| Gene Name | DNM1L | ||
| Gene ID | 10059 | ||
| Synonyms |
DNM1L, DLP1, DRP1, DVLP, DYMPLE, EMPF, EMPF1, HDYNIV, OPA5
|
||
| Sequence |
MEALIPVINKLQDVFNTVGADIIQLPQIVVVGTQSSGKSSVLESLVGRDLLPRGTGIVTR
RPLILQLVHVSQEDKRKTTGEENGVEAEEWGKFLHTKNKLYTDFDEIRQEIENETERISG NNKGVSPEPIHLKIFSPNVVNLTLVDLPGMTKVPVGDQPKDIELQIRELILRFISNPNSI ILAVTAANTDMATSEALKISREVDPDGRRTLAVITKLDLMDAGTDAMDVLMGRVIPVKLG IIGVVNRSQLDINNKKSVTDSIRDEYAFLQKKYPSLANRNGTKYLARTLNRLLMHHIRDC LPELKTRINVLAAQYQSLLNSYGEPVDDKSATLLQLITKFATEYCNTIEGTAKYIETSEL CGGARICYIFHETFGRTLESVDPLGGLNTIDILTAIRNATGPRPALFVPEVSFELLVKRQ IKRLEEPSLRCVELVHEEMQRIIQHCSNYSTQELLRFPKLHDAIVEVVTCLLRKRLPVTN EMVHNLVAIELAYINTKHPDFADACGLMNNNIEEQRRNRLARELPSAVSRDKSSKVPSAL APASQEPSPAASAEADGKLIQDSRRETKNVASGGGGVGDGVQEPTTGNWRGMLKTSKAEE LLAEEKSKPIPIMPASPQKGHAVNLLDVPVPVARKLSAREQRDCEVIERLIKSYFLIVRK NIQDSVPKAVMHFLVNHVKDTLQSELVGQLYKSSLLDDLLTESEDMAQRRKEAADMLKAL QGASQIIAEIRETHLW |
||
| Pathway Map | MAP LINK | ||
| T.C. Number | 1.N.6.1.2 | ||
| KEGG ID | hsa10059 | ||
| Pfam | PF00350; PF01031; PF01580; PF01926; PF02212; PF13191 | ||
| Pair Name | Hesperetin, Sorafenib | |||
| Phytochemical Name | Hesperetin | |||
| Anticancer drug Name | Sorafenib | |||
| Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
| Regulate Info | Down-regulation | Dynamin-1-like protein | Expression | |
| Result | Hesperetin exhibits potential as an adjunct to sorafenib, mitigating its side effects by attenuating its toxicity, enhancing efficacy, and potentially reducing the occurrence of sorafenib-induced resistance through the downregulation of hepatocyte growth factor levels. | |||
| Pair Name | Piperlongumine, Cisplatin | |||
| Phytochemical | Piperlongumine | |||
| Drug | Cisplatin | |||
| Disease Info | [ICD-11: 2C94.Z] | Bladder cancer | Investigative | |
| Regulate Info | Up-regulation | Dynamin-1-like protein | Phosphorylation | |
| Result | Our results demonstrated the role of RIPK1 in cisplatin-resistant cells and the sensitization effect of the natural drug PL on bladder cancer. These may provide a new treatment strategy for overcoming cisplatin resistance in bladder cancer. | |||
| Pair Name | Cepharanthine, Epirubicin | |||
| Phytochemical | Cepharanthine | |||
| Drug | Epirubicin | |||
| Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
| Regulate Info | Down-regulation | Dynamin-1-like protein | Phosphorylation | |
| Result | Cepharanthine sensitizes human triple negative breast cancer cells to chemotherapeutic agent epirubicin via inducing cofilin oxidation-mediated mitochondrial fission and apoptosis | |||
| Pair Name | Baicalein, Doxorubicin | |||
| Phytochemical | Baicalein | |||
| Drug | Doxorubicin | |||
| Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
| Regulate Info | Down-regulation | Dynamin-1-like protein | Phosphorylation | |
| Result | Baicalein sensitizes triple negative breast cancer MDA-MB-231 cells to doxorubicin via autophagy-mediated down-regulation of CDK1 | |||
| Pair Name | Isorhamnetin, Chloroquine | |||
| Phytochemical | Isorhamnetin | |||
| Drug | Chloroquine | |||
| Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
| Regulate Info | Up-regulation | Dynamin-1-like protein | Phosphorylation | |
| Result | Our study highlights the critical role of ROS-mediating CaMKII/Drp1 signaling in the regulation of mitochondrial fission and apoptosis induced by combination of CQ/IH. These findings also suggest that IH could potentially be further developed as a novel chemotherapeutic agent. Furthermore, a combination of IH with classic autophagy/mitophagy inhibitor could represent a novel therapeutic strategy for the treatment of TNBC. | |||
| Pair Name | Luteolin, TNF-related apoptosis inducing ligand | |||
| Phytochemical | Luteolin | |||
| Drug | TNF-related apoptosis inducing ligand | |||
| Disease Info | [ICD-11: 2C25.Z] | Lung cancer | Investigative | |
| Regulate Info | Up-regulation | Dynamin-1-like protein | Expression | |
| Result | TRAIL combined with luteolin could be as an effective chemotherapeutic strategy for NSCLC. | |||
| No. | Title | Href |
|---|---|---|
| 1 | Protective role of hesperetin in sorafenib-induced hepato- and neurotoxicity in mice via modulating apoptotic pathways and mitochondrial reprogramming. Life Sci. 2024 Jan 1;336:122295. doi: 10.1016/j.lfs.2023.122295. | Click |
| 2 | Piperlongumine increases the sensitivity of bladder cancer to cisplatin by mitochondrial ROS. J Clin Lab Anal. 2022 Jun;36(6):e24452. doi: 10.1002/jcla.24452. | Click |
| 3 | Cepharanthine sensitizes human triple negative breast cancer cells to chemotherapeutic agent epirubicin via inducing cofilin oxidation-mediated mitochondrial fission and apoptosis. Acta Pharmacol Sin. 2022 Jan;43(1):177-193. doi: 10.1038/s41401-021-00715-3. | Click |
| 4 | Baicalein sensitizes triple negative breast cancer MDA-MB-231 cells to doxorubicin via autophagy-mediated down-regulation of CDK1. Mol Cell Biochem. 2023 Jul;478(7):1519-1531. doi: 10.1007/s11010-022-04597-9. | Click |
| 5 | ROS-mediated activation and mitochondrial translocation of CaMKII contributes to Drp1-dependent mitochondrial fission and apoptosis in triple-negative breast cancer cells by isorhamnetin and chloroquine. J Exp Clin Cancer Res. 2019 May 28;38(1):225. doi: 10.1186/s13046-019-1201-4. | Click |
| 6 | Luteolin enhances TRAIL sensitivity in non-small cell lung cancer cells through increasing DR5 expression and Drp1-mediated mitochondrial fission. Arch Biochem Biophys. 2020 Oct 15;692:108539. doi: 10.1016/j.abb.2020.108539. | Click |