Name | Cyclin-dependent kinase inhibitor 2A | ||
UniProt ID | CDN2A_HUMAN | ||
Gene Name | CDKN2A | ||
Gene ID | 1029 | ||
Synonyms |
CDKN2A, ARF, CAI2, CDK4I, CDKN2, CMM2, INK4, INK4A, MLM, MTS-1, MTS1, P14, P14ARF, P16, P16-INK4A, P16INK4, P16INK4A, P19, P19ARF, TP16
|
||
Sequence |
MEPAAGSSMEPSADWLATAAARGRVEEVRALLEAGALPNAPNSYGRRPIQVMMMGSARVA
ELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEE LGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPD |
||
Pathway Map | MAP LINK | ||
KEGG ID | hsa1029 | ||
TTD ID | T16452 | ||
Pfam | PF00023; PF12796; PF13637; PF13857 |
Pair Name | Artesunate, Fluorouracil | |||
Phytochemical Name | Artesunate | |||
Anticancer drug Name | Fluorouracil | |||
Disease Info | [ICD-11: 2B91.Z] | Colorectal cancer | Investigative | |
Regulate Info | Down-regulation | Cyclin-dependent kinase inhibitor 2A | Expression | |
Result | Our findings point to the crucial treatment effect of Arte on inflammation, intestinal cell senescence, and CRC cell proliferation and offer a new option for CRC treatment. |
Pair Name | Resveratrol, Cisplatin | |||
Phytochemical Name | Resveratrol | |||
Anticancer drug Name | Cisplatin | |||
Disease Info | [ICD-11: 2B72.Z] | Gastric cancer | Investigative | |
Regulate Info | Up-regulation | Cyclin-dependent kinase inhibitor 2A | Expression | |
Result | Combination therapy of cisplatin and resveratrol to induce cellular aging in gastric cancer cells: Focusing on oxidative stress, and cell cycle arrest |
Pair Name | Homoharringtonine, Cisplatin | |||
Phytochemical | Homoharringtonine | |||
Drug | Cisplatin | |||
Disease Info | [ICD-11: 2C73] | Ovarian cancer | Investigative | |
Regulate Info | Down-regulation | Cyclin-dependent kinase inhibitor 2A | Expression | |
Result | Combinatorial treatment of ovarian cancer cells with harringtonine and cisplatin results in increased cisplatin-DNA adducts |
Pair Name | Tanshinone I, Paclitaxel | |||
Phytochemical | Tanshinone I | |||
Drug | Paclitaxel | |||
Disease Info | [ICD-11: 2C73] | Ovarian cancer | Investigative | |
Regulate Info | Up-regulation | Cyclin-dependent kinase inhibitor 2A | Expression | |
Result | Natural compound Tan-I enhances the efficacy of ovarian cancer to Paclitaxel chemotherapy. The results will help to supply the potential clinical use of ovarian carcinoma cells. |
Pair Name | Sulforaphane, Clofarabine | |||
Phytochemical | Sulforaphane | |||
Drug | Clofarabine | |||
Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
Regulate Info | Up-regulation | Cyclin-dependent kinase inhibitor 2A | Expression | |
Result | We showed that clofarabine in combination with sulforaphane, a phytochemical from cruciferous vegetables, significantly reactivates DNA methylation-silenced CDKN2A tumour suppressor and inhibits cancer cell growth at a non-invasive breast cancer stage. |
No. | Title | Href |
---|---|---|
1 | Artesunate alleviates 5-fluorouracil-induced intestinal damage by suppressing cellular senescence and enhances its antitumor activity. Discov Oncol. 2023 Jul 27;14(1):139. doi: 10.1007/s12672-023-00747-7. | Click |
2 | Combination therapy of cisplatin and resveratrol to induce cellular aging in gastric cancer cells: Focusing on oxidative stress, and cell cycle arrest. Front Pharmacol. 2023;13:1068863. Published 2023 Jan 4. doi:10.3389/fphar.2022.1068863. | Click |
3 | Combinatorial treatment of ovarian cancer cells with harringtonine and cisplatin results in increased cisplatin-DNA adducts. Oncol Rep. 2004 Apr;11(4):833-8. | Click |
4 | Natural compound Tan-I enhances the efficacy of Paclitaxel chemotherapy in ovarian cancer. Ann Transl Med. 2020 Jun;8(12):752. doi: 10.21037/atm-20-4072. | Click |
5 | Inhibition of breast cancer cell growth by the combination of clofarabine and sulforaphane involves epigenetically mediated CDKN2A upregulation. Nucleosides Nucleotides Nucleic Acids. 2018;37(5):280-289. doi: 10.1080/15257770.2018.1453075. | Click |