| Name | Cyclin-dependent kinase inhibitor 2A | ||
| UniProt ID | CDN2A_HUMAN | ||
| Gene Name | CDKN2A | ||
| Gene ID | 1029 | ||
| Synonyms |
CDKN2A, ARF, CAI2, CDK4I, CDKN2, CMM2, INK4, INK4A, MLM, MTS-1, MTS1, P14, P14ARF, P16, P16-INK4A, P16INK4, P16INK4A, P19, P19ARF, TP16
|
||
| Sequence |
MEPAAGSSMEPSADWLATAAARGRVEEVRALLEAGALPNAPNSYGRRPIQVMMMGSARVA
ELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEE LGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPD |
||
| Pathway Map | MAP LINK | ||
| KEGG ID | hsa1029 | ||
| TTD ID | T16452 | ||
| Pfam | PF00023; PF12796; PF13637; PF13857 | ||
| Pair Name | Artesunate, Fluorouracil | |||
| Phytochemical Name | Artesunate | |||
| Anticancer drug Name | Fluorouracil | |||
| Disease Info | [ICD-11: 2B91.Z] | Colorectal cancer | Investigative | |
| Regulate Info | Down-regulation | Cyclin-dependent kinase inhibitor 2A | Expression | |
| Result | Our findings point to the crucial treatment effect of Arte on inflammation, intestinal cell senescence, and CRC cell proliferation and offer a new option for CRC treatment. | |||
| Pair Name | Resveratrol, Cisplatin | |||
| Phytochemical Name | Resveratrol | |||
| Anticancer drug Name | Cisplatin | |||
| Disease Info | [ICD-11: 2B72.Z] | Gastric cancer | Investigative | |
| Regulate Info | Up-regulation | Cyclin-dependent kinase inhibitor 2A | Expression | |
| Result | Combination therapy of cisplatin and resveratrol to induce cellular aging in gastric cancer cells: Focusing on oxidative stress, and cell cycle arrest | |||
| Pair Name | Homoharringtonine, Cisplatin | |||
| Phytochemical | Homoharringtonine | |||
| Drug | Cisplatin | |||
| Disease Info | [ICD-11: 2C73] | Ovarian cancer | Investigative | |
| Regulate Info | Down-regulation | Cyclin-dependent kinase inhibitor 2A | Expression | |
| Result | Combinatorial treatment of ovarian cancer cells with harringtonine and cisplatin results in increased cisplatin-DNA adducts | |||
| Pair Name | Tanshinone I, Paclitaxel | |||
| Phytochemical | Tanshinone I | |||
| Drug | Paclitaxel | |||
| Disease Info | [ICD-11: 2C73] | Ovarian cancer | Investigative | |
| Regulate Info | Up-regulation | Cyclin-dependent kinase inhibitor 2A | Expression | |
| Result | Natural compound Tan-I enhances the efficacy of ovarian cancer to Paclitaxel chemotherapy. The results will help to supply the potential clinical use of ovarian carcinoma cells. | |||
| Pair Name | Sulforaphane, Clofarabine | |||
| Phytochemical | Sulforaphane | |||
| Drug | Clofarabine | |||
| Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
| Regulate Info | Up-regulation | Cyclin-dependent kinase inhibitor 2A | Expression | |
| Result | We showed that clofarabine in combination with sulforaphane, a phytochemical from cruciferous vegetables, significantly reactivates DNA methylation-silenced CDKN2A tumour suppressor and inhibits cancer cell growth at a non-invasive breast cancer stage. | |||
| No. | Title | Href |
|---|---|---|
| 1 | Artesunate alleviates 5-fluorouracil-induced intestinal damage by suppressing cellular senescence and enhances its antitumor activity. Discov Oncol. 2023 Jul 27;14(1):139. doi: 10.1007/s12672-023-00747-7. | Click |
| 2 | Combination therapy of cisplatin and resveratrol to induce cellular aging in gastric cancer cells: Focusing on oxidative stress, and cell cycle arrest. Front Pharmacol. 2023;13:1068863. Published 2023 Jan 4. doi:10.3389/fphar.2022.1068863. | Click |
| 3 | Combinatorial treatment of ovarian cancer cells with harringtonine and cisplatin results in increased cisplatin-DNA adducts. Oncol Rep. 2004 Apr;11(4):833-8. | Click |
| 4 | Natural compound Tan-I enhances the efficacy of Paclitaxel chemotherapy in ovarian cancer. Ann Transl Med. 2020 Jun;8(12):752. doi: 10.21037/atm-20-4072. | Click |
| 5 | Inhibition of breast cancer cell growth by the combination of clofarabine and sulforaphane involves epigenetically mediated CDKN2A upregulation. Nucleosides Nucleotides Nucleic Acids. 2018;37(5):280-289. doi: 10.1080/15257770.2018.1453075. | Click |
