TOP
Nav Bar
  1. General Info
  2. Effects Info
  3. Reference
Molecular Details
01. General Information
Name M-phase inducer phosphatase 3
UniProt ID MPIP3_HUMAN
Gene Name CDC25C
Gene ID 995
Synonyms
CDC25C, CDC25, PPP1R60
Sequence
MSTELFSSTREEGSSGSGPSFRSNQRKMLNLLLERDTSFTVCPDVPRTPVGKFLGDSANL
SILSGGTPKRCLDLSNLSSGEITATQLTTSADLDETGHLDSSGLQEVHLAGMNHDQHLMK
CSPAQLLCSTPNGLDRGHRKRDAMCSSSANKENDNGNLVDSEMKYLGSPITTVPKLDKNP
NLGEDQAEEISDELMEFSLKDQEAKVSRSGLYRSPSMPENLNRPRLKQVEKFKDNTIPDK
VKKKYFSGQGKLRKGLCLKKTVSLCDITITQMLEEDSNQGHLIGDFSKVCALPTVSGKHQ
DLKYVNPETVAALLSGKFQGLIEKFYVIDCRYPYEYLGGHIQGALNLYSQEELFNFFLKK
PIVPLDTQKRIIIVFHCEFSSERGPRMCRCLREEDRSLNQYPALYYPELYILKGGYRDFF
PEYMELCEPQSYCPMHHQDHKTELLRCRSQSKVQEGERQLREQIALLVKDMSP
Pathway Map MAP LINK
KEGG ID hsa995
Pfam PF00581; PF06617
02. Combinatorial Therapeutic Effect(s)
Synergistic Effect
Hide/Show
Decreasing Drug Toxicity
Hide/Show
Combination Pair ID: 75
Pair Name Baicalein, Docetaxel
Phytochemical Name Baicalein
Anticancer drug Name Docetaxel
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Down-regulation M-phase inducer phosphatase 3 Expression
Result Baicalein enhances the antitumor efficacy of docetaxel on nonsmall cell lung cancer in a β-catenin-dependent manner
Enhancing Drug Efficacy
Hide/Show
Combination Pair ID: 64
Pair Name Luteolin, Oxaliplatin
Phytochemical Luteolin
Drug Oxaliplatin
Disease Info [ICD-11: 2B72.Z] Gastric cancer Investigative
Regulate Info Down-regulation M-phase inducer phosphatase 3 Expression
Result Luteolin potentiates low-dose oxaliplatin-induced inhibitory effects on cell proliferation in gastric cancer by inducing G2/M cell cycle arrest and apoptosis
Combination Pair ID: 100
Pair Name Silibinin, Paclitaxel
Phytochemical Silibinin
Drug Paclitaxel
Disease Info [ICD-11: 2B72.Z] Gastric cancer Investigative
Regulate Info Down-regulation M-phase inducer phosphatase 3 Expression
Result Synergistic apoptotic effects of silibinin in enhancing paclitaxel toxicity in human gastric cancer cell lines
Combination Pair ID: 134
Pair Name Flavokawain A, Herceptin
Phytochemical Flavokawain A
Drug Herceptin
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Down-regulation M-phase inducer phosphatase 3 Phosphorylation
Result Our results suggest FKA as a promising and novel apoptosis inducer and G2 blocking agent that, in combination with Herceptin, enhances for the treatment of HER2-overexpressing breast cancer.
Combination Pair ID: 141
Pair Name Silibinin, Doxorubicin
Phytochemical Silibinin
Drug Doxorubicin
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Up-regulation M-phase inducer phosphatase 3 Expression
Result Inhibitory effects of Silibinin combined with doxorubicin in hepatocellular carcinoma; an in vivo study
Combination Pair ID: 375
Pair Name Resveratrol, Cisplatin
Phytochemical Resveratrol
Drug Cisplatin
Disease Info [ICD-11: 2B72.Z] Gastric cancer Investigative
Regulate Info Down-regulation M-phase inducer phosphatase 3 Expression
Result These results indicated that RES is a promising adjuvant for DDP during GC chemotherapy.
Combination Pair ID: 902
Pair Name Sulforaphane, Gemcitabine
Phytochemical Sulforaphane
Drug Gemcitabine
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Down-regulation M-phase inducer phosphatase 3 Phosphorylation
Result Sulforaphane Potentiates Gemcitabine-Mediated Anti-Cancer Effects against Intrahepatic Cholangiocarcinoma by Inhibiting HDAC Activity
Reversing Drug Resistance
Hide/Show
Combination Pair ID: 17
Pair Name Raloxifene hydrochloride, Paclitaxel
Phytochemical Raloxifene hydrochloride
Drug Paclitaxel
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation M-phase inducer phosphatase 3 Phosphorylation
Result Reversal effects of Raloxifene on paclitaxel resistance in 2 MDR breast cancer cells
Combination Pair ID: 17
Pair Name Raloxifene hydrochloride, Paclitaxel
Phytochemical Raloxifene hydrochloride
Drug Paclitaxel
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation M-phase inducer phosphatase 3 Phosphorylation
Result Reversal effects of Raloxifene on paclitaxel resistance in 2 MDR breast cancer cells
03. Reference
No. Title Href
1 Baicalein enhances the antitumor efficacy of docetaxel on nonsmall cell lung cancer in a β-catenin-dependent manner. Phytother Res. 2020 Jan;34(1):104-117. doi: 10.1002/ptr.6501. Click
2 Luteolin potentiates low-dose oxaliplatin-induced inhibitory effects on cell proliferation in gastric cancer by inducing G2/M cell cycle arrest and apoptosis. Oncol Lett. 2022 Jan;23(1):16. doi: 10.3892/ol.2021.13134. Click
3 Synergistic apoptotic effects of silibinin in enhancing paclitaxel toxicity in human gastric cancer cell lines. Mol Med Rep. 2018 Aug;18(2):1835-1841. doi: 10.3892/mmr.2018.9129. Click
4 Induction of G2M Arrest by Flavokawain A, a Kava Chalcone, Increases the Responsiveness of HER2-Overexpressing Breast Cancer Cells to Herceptin. Molecules. 2017 Mar 14;22(3):462. doi: 10.3390/molecules22030462. Click
5 Inhibitory effects of Silibinin combined with doxorubicin in hepatocellular carcinoma; an in vivo study. J BUON. 2016 Jul-Aug;21(4):917-924. Click
6 Resveratrol synergizes with cisplatin in antineoplastic effects against AGS gastric cancer cells by inducing endoplasmic reticulum stress‑mediated apoptosis and G2/M phase arrest. Oncol Rep. 2020 Oct;44(4):1605-1615. doi: 10.3892/or.2020.7708. Click
7 Sulforaphane Potentiates Gemcitabine-Mediated Anti-Cancer Effects against Intrahepatic Cholangiocarcinoma by Inhibiting HDAC Activity. Cells. 2023 Feb 22;12(5):687. doi: 10.3390/cells12050687. Click
8 Reversal effects of Raloxifene on paclitaxel resistance in 2 MDR breast cancer cells. Cancer Biol Ther. 2015;16(12):1794-801. doi: 10.1080/15384047.2015.1095409. Click
9 Reversal effects of Raloxifene on paclitaxel resistance in 2 MDR breast cancer cells. Cancer Biol Ther. 2015;16(12):1794-801. doi: 10.1080/15384047.2015.1095409. Click
It has been 548535 visits since 2024.08
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang
TOP