InterPAD - DETAILS

MKFGMGSAQACPCQVPRAASTTWVPCQICGPRERHGPRTPGGQLPGARRGPGPRRPAPLP
ARPPGALGSVLRPLRARPGCRPRRPHPAARCLPLRPHRPTRRHRRPGGFPLAWGSPQPAP
RPAPGRSSALALAGGAAPGVARAQRPGGSGGRSHPGGPGSPRGGGTVGPGDRGPAAADGG
RPQRTVRAAETRGAAAAPPLTLEGPVQSHHGTPALTQGPQSPRDGAQLGACTRPVDVRDS
GGRPLPPPDTLASAGDFLCTM

No.	Title	Href
1	Synergistic antitumour activity of sorafenib in combination with tetrandrine is mediated by reactive oxygen species (ROS)/Akt signaling. Br J Cancer. 2013 Jul 23;109(2):342-50. doi: 10.1038/bjc.2013.334.	`Click`
2	Amygdalin as a chemoprotective agent in co-treatment with cisplatin. Front Pharmacol. 2022 Sep 20;13:1013692. doi: 10.3389/fphar.2022.1013692.	`Click`
3	Combining triptolide with ABT-199 is effective against acute myeloid leukemia through reciprocal regulation of Bcl-2 family proteins and activation of the intrinsic apoptotic pathway. Cell Death Dis. 2020 Jul 22;11(7):555. doi: 10.1038/s41419-020-02762-w.	`Click`
4	Ginsenoside Rg5 Sensitizes Paclitaxel-Resistant Human Cervical-Adeno-Carcinoma Cells to Paclitaxel-And Enhances the Anticancer Effect of Paclitaxel. Genes (Basel). 2022 Jun 24;13(7):1142. doi: 10.3390/genes13071142.	`Click`
5	Indomethacin and juglone inhibit inflammatory molecules to induce apoptosis in colon cancer cells. J Biochem Mol Toxicol. 2020 Feb;34(2):e22433. doi: 10.1002/jbt.22433.	`Click`
6	Synergistic anticancer activity of capsaicin and 3,3'-diindolylmethane in human colorectal cancer. J Agric Food Chem. 2015 May 6;63(17):4297-304. doi: 10.1021/jf506098s.	`Click`
7	6-Shogaol induces apoptosis in acute lymphoblastic leukaemia cells by targeting p53 signalling pathway and generation of reactive oxygen species. J Cell Mol Med. 2021 May 3;25(13):6148–60. doi: 10.1111/jcmm.16528.	`Click`

No.

Title

Href

Synergistic antitumour activity of sorafenib in combination with tetrandrine is mediated by reactive oxygen species (ROS)/Akt signaling. Br J Cancer. 2013 Jul 23;109(2):342-50. doi: 10.1038/bjc.2013.334.

Click

Amygdalin as a chemoprotective agent in co-treatment with cisplatin. Front Pharmacol. 2022 Sep 20;13:1013692. doi: 10.3389/fphar.2022.1013692.

Click

Combining triptolide with ABT-199 is effective against acute myeloid leukemia through reciprocal regulation of Bcl-2 family proteins and activation of the intrinsic apoptotic pathway. Cell Death Dis. 2020 Jul 22;11(7):555. doi: 10.1038/s41419-020-02762-w.

Click

Ginsenoside Rg5 Sensitizes Paclitaxel-Resistant Human Cervical-Adeno-Carcinoma Cells to Paclitaxel-And Enhances the Anticancer Effect of Paclitaxel. Genes (Basel). 2022 Jun 24;13(7):1142. doi: 10.3390/genes13071142.

Click

Indomethacin and juglone inhibit inflammatory molecules to induce apoptosis in colon cancer cells. J Biochem Mol Toxicol. 2020 Feb;34(2):e22433. doi: 10.1002/jbt.22433.

Click

Synergistic anticancer activity of capsaicin and 3,3'-diindolylmethane in human colorectal cancer. J Agric Food Chem. 2015 May 6;63(17):4297-304. doi: 10.1021/jf506098s.

Click

6-Shogaol induces apoptosis in acute lymphoblastic leukaemia cells by targeting p53 signalling pathway and generation of reactive oxygen species. J Cell Mol Med. 2021 May 3;25(13):6148–60. doi: 10.1111/jcmm.16528.

Click

Name	Bcl-2-binding component 3, isoforms 1/2
UniProt ID	BBC3_HUMAN
Gene Name	BBC3
Gene ID	27113
Synonyms	BBC3, JFY-1, JFY1, PUMA
Sequence	MKFGMGSAQACPCQVPRAASTTWVPCQICGPRERHGPRTPGGQLPGARRGPGPRRPAPLP ARPPGALGSVLRPLRARPGCRPRRPHPAARCLPLRPHRPTRRHRRPGGFPLAWGSPQPAP RPAPGRSSALALAGGAAPGVARAQRPGGSGGRSHPGGPGSPRGGGTVGPGDRGPAAADGG RPQRTVRAAETRGAAAAPPLTLEGPVQSHHGTPALTQGPQSPRDGAQLGACTRPVDVRDS GGRPLPPPDTLASAGDFLCTM
Pathway Map	`MAP LINK`
KEGG ID	hsa27113
TTD ID	T21460

Pair Name	Tetrandrine, Sorafenib
Phytochemical	Tetrandrine
Drug	Sorafenib
Disease Info	[ICD-11: 2C12]	Hepatocellular carcinoma	Investigative
Regulate Info	Up-regulation	Bcl-2-binding component 3, isoforms 1/2	Expression
Result	The antitumour activity of sorafenib plus tetrandrine may be attributed to the induction of the intrinsic apoptosis pathway through ROS/Akt signaling. This finding provides a novel approach that may broaden the clinical application of sorafenib.

Pair Name	Amygdalin, Cisplatin
Phytochemical	Amygdalin
Drug	Cisplatin
Disease Info	[ICD-11: 2C60]	Breast cancer	Investigative
Regulate Info	Down-regulation	Bcl-2-binding component 3, isoforms 1/2	Expression
Result	Our present findings suggest that amygdalin has chemo-modulatory effect when used in co-treatment with cisplatin and is able to protect normal breast cells as well as the fibroblasts during chemotherapy treatment, indicating a strong selective chemoprotective ability and may contribute to a better quality of life for cancer patients.

Pair Name	Triptolide, ABT-199
Phytochemical	Triptolide
Drug	ABT-199
Disease Info	[ICD-11: 2A60.Z]	Acute myeloid leukemia	Investigative
Regulate Info	Up-regulation	Bcl-2-binding component 3, isoforms 1/2	Expression
Result	These findings suggest that the regimen combining TPL and ABT-199 might be active against AML by inducing robust apoptosis through reciprocal regulation of anti- and proapoptotic Bcl-2 family proteins, therefore providing a strong rationale for the clinical investigation of this combination regimen for the treatment of AML.

Pair Name	Ginsenoside Rg5, Paclitaxel
Phytochemical	Ginsenoside Rg5
Drug	Paclitaxel
Disease Info	[ICD-11: 2C77.Z]	Cervical cancer	Investigative
Regulate Info	Up-regulation	Bcl-2-binding component 3, isoforms 1/2	Expression
Result	Ginsenoside Rg5 Sensitizes Paclitaxel-Resistant Human Cervical-Adeno-Carcinoma Cells to Paclitaxel-And Enhances the Anticancer Effect of Paclitaxel

Pair Name	Juglone, Indomethacin
Phytochemical	Juglone
Drug	Indomethacin
Disease Info	[ICD-11: 2B90.Z]	Colon cancer	Investigative
Regulate Info	Up-regulation	Bcl-2-binding component 3, isoforms 1/2	Expression
Result	A combination of both was shown to be more effective, suggesting that juglone may be considered for therapeutic intervention of colon cancer.

Pair Name	Capsaicin, 3,3'-diindolylmethane
Phytochemical	Capsaicin
Drug	3,3'-diindolylmethane
Disease Info	[ICD-11: 2B90.Z]	Colon cancer	Investigative
Regulate Info	Up-regulation	Bcl-2-binding component 3, isoforms 1/2	Expression
Result	The present study suggests capsaicin and DIM work synergistically to inhibit cell proliferation and induce apoptosis in colorectal cancer through modulating transcriptional activity of NF-κB, p53, and target genes associated with apoptosis.

Pair Name	Shogaol, Methotrexate
Phytochemical	Shogaol
Drug	Methotrexate
Disease Info	[ICD-11: 2B33.3]	Acute lymphoblastic leukemia	Investigative
Regulate Info	Up-regulation	Bcl-2-binding component 3, isoforms 1/2	Expression
Result	The current study revealed the in vivo novel anti-leukaemic role of ginger extract, promoted by MTX. Moreover, 6-shogaol was introduced as the major player of ginger cytotoxicity through inducing p53 activity and ROS generation.