| Name | Apoptotic protease-activating factor 1 | ||
| UniProt ID | APAF_HUMAN | ||
| Gene Name | APAF1 | ||
| Gene ID | 317 | ||
| Synonyms |
APAF1, APAF-1, CED4
|
||
| Sequence |
MDAKARNCLLQHREALEKDIKTSYIMDHMISDGFLTISEEEKVRNEPTQQQRAAMLIKMI
LKKDNDSYVSFYNALLHEGYKDLAALLHDGIPVVSSSSGKDSVSGITSYVRTVLCEGGVP QRPVVFVTRKKLVNAIQQKLSKLKGEPGWVTIHGMAGCGKSVLAAEAVRDHSLLEGCFPG GVHWVSVGKQDKSGLLMKLQNLCTRLDQDESFSQRLPLNIEEAKDRLRILMLRKHPRSLL ILDDVWDSWVLKAFDSQCQILLTTRDKSVTDSVMGPKYVVPVESSLGKEKGLEILSLFVN MKKADLPEQAHSIIKECKGSPLVVSLIGALLRDFPNRWEYYLKQLQNKQFKRIRKSSSYD YEALDEAMSISVEMLREDIKDYYTDLSILQKDVKVPTKVLCILWDMETEEVEDILQEFVN KSLLFCDRNGKSFRYYLHDLQVDFLTEKNCSQLQDLHKKIITQFQRYHQPHTLSPDQEDC MYWYNFLAYHMASAKMHKELCALMFSLDWIKAKTELVGPAHLIHEFVEYRHILDEKDCAV SENFQEFLSLNGHLLGRQPFPNIVQLGLCEPETSEVYQQAKLQAKQEVDNGMLYLEWINK KNITNLSRLVVRPHTDAVYHACFSEDGQRIASCGADKTLQVFKAETGEKLLEIKAHEDEV LCCAFSTDDRFIATCSVDKKVKIWNSMTGELVHTYDEHSEQVNCCHFTNSSHHLLLATGS SDCFLKLWDLNQKECRNTMFGHTNSVNHCRFSPDDKLLASCSADGTLKLWDATSANERKS INVKQFFLNLEDPQEDMEVIVKCCSWSADGARIMVAAKNKIFLFDIHTSGLLGEIHTGHH STIQYCDFSPQNHLAVVALSQYCVELWNTDSRSKVADCRGHLSWVHGVMFSPDGSSFLTS SDDQTIRLWETKKVCKNSAVMLKQEVDVVFQENEVMVLAVDHIRRLQLINGRTGQIDYLT EAQVSCCCLSPHLQYIAFGDENGAIEILELVNNRIFQSRFQHKKTVWHIQFTADEKTLIS SSDDAEIQVWNWQLDKCIFLRGHQETVKDFRLLKNSRLLSWSFDGTVKVWNIITGNKEKD FVCHQGTVLSCDISHDATKFSSTSADKTAKIWSFDLLLPLHELRGHNGCVRCSAFSVDST LLATGDDNGEIRIWNVSNGELLHLCAPLSEEGAATHGGWVTDLCFSPDGKMLISAGGYIK WWNVVTGESSQTFYTNGTNLKKIHVSPDFKTYVTVDNLGILYILQTLE |
||
| Pathway Map | MAP LINK | ||
| T.C. Number | 8.A.92.1.11 | ||
| KEGG ID | hsa317 | ||
| Pfam | PF00400; PF00619; PF00931; PF05729; PF08662; PF10395; PF11715; PF12894; PF13191; PF13238; PF13401; PF16529; PF16739; PF17005; PF17908; PF20426; PF20703; PF21029; PF21296 | ||
| Pair Name | [6]-Gingerol, Cisplatin | |||
| Phytochemical | [6]-Gingerol | |||
| Drug | Cisplatin | |||
| Disease Info | [ICD-11: 2C73] | Ovarian cancer | Investigative | |
| Regulate Info | Up-regulation | Apoptotic protease-activating factor 1 | Expression | |
| Result | The findings of the present study demonstrated that the cisplatin and 6-gingerol combination is more effective in inducing apoptosis and suppressing the angiogenesis of ovarian cancer cells than using each drug alone. | |||
| Pair Name | Alpha-Hederin, Cisplatin | |||
| Phytochemical | Alpha-Hederin | |||
| Drug | Cisplatin | |||
| Disease Info | [ICD-11: 2B72] | Gastric cancer | Investigative | |
| Regulate Info | Up-regulation | Apoptotic protease-activating factor 1 | Expression | |
| Result | α-Hederin enhances cisplatin-induced anti-tumour effects in GC both in vitro and in vivo by promoting the accumulation of ROS and decreasing MMP. Our data strongly suggested that α-Hederin is a promising candidate for intervention in gastric cancer. | |||
| Pair Name | Bufalin, Sorafenib | |||
| Phytochemical | Bufalin | |||
| Drug | Sorafenib | |||
| Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
| Regulate Info | Up-regulation | Apoptotic protease-activating factor 1 | Expression | |
| Result | Sorafenib in combination with bufalin shows more potent cytotoxic effects and cell apoptosis than sorafenib or bufalin treatment alone in NCI-H292 cells. The combined treatment significantly enhanced apoptotic cell death in NCI-H292 lung cancer cells by activating ROS-, mitochondria-, and caspase-signaling pathways in vitro. | |||
| Pair Name | Gamma-Tocotrienol, Docetaxel | |||
| Phytochemical | Gamma-Tocotrienol | |||
| Drug | Docetaxel | |||
| Disease Info | [ICD-11: 2B66.Z] | Oral cancer | Investigative | |
| Regulate Info | Up-regulation | Apoptotic protease-activating factor 1 | Expression | |
| Result | These findings suggest that the combination treatment with these agents may provide enhanced therapeutic response in oral cancer patients, while avoiding the toxicity associated with high-dose β-tubulin stabilization monotherapy. | |||
| Pair Name | Ginsenoside Rg1, Doxorubicin | |||
| Phytochemical | Ginsenoside Rg1 | |||
| Drug | Doxorubicin | |||
| Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
| Regulate Info | Up-regulation | Apoptotic protease-activating factor 1 | Expression | |
| Result | The present results support the chemosensitizing property of ginsenoside Rg1 in triple-negative breast cancer cell lines. | |||
| Pair Name | Glucosinalbate, Doxorubicin | |||
| Phytochemical | Glucosinalbate | |||
| Drug | Doxorubicin | |||
| Disease Info | [ICD-11: 2C90] | Ehrlich ascites carcinoma | Investigative | |
| Regulate Info | Up-regulation | Apoptotic protease-activating factor 1 | Expression | |
| Result | The present study clearly suggested therapeutic benefit of I3C in combination with DOX by augmenting anticancer efficacy and diminishing toxicity to the host. | |||
| Pair Name | Cepharanthine, Cisplatin | |||
| Phytochemical | Cepharanthine | |||
| Drug | Cisplatin | |||
| Disease Info | [ICD-11: 2B70] | Esophageal cancer | Investigative | |
| Regulate Info | Up-regulation | Apoptotic protease-activating factor 1 | Expression | |
| Result | Cepharanthine hydrochloride reverses the mdr1 (P-glycoprotein)-mediated esophageal squamous cell carcinoma cell cisplatin resistance through JNK and p53 signals | |||
| No. | Title | Href |
|---|---|---|
| 1 | The inhibitory effect of 6-gingerol and cisplatin on ovarian cancer and antitumor activity: In silico, in vitro, and in vivo. Front Oncol. 2023 Mar 3;13:1098429. doi: 10.3389/fonc.2023.1098429. | Click |
| 2 | Combining α-Hederin with cisplatin increases the apoptosis of gastric cancer in vivo and in vitro via mitochondrial related apoptosis pathway. Biomed Pharmacother. 2019 Dec;120:109477. doi: 10.1016/j.biopha.2019.109477. | Click |
| 3 | Combination Treatment of Sorafenib and Bufalin Induces Apoptosis in NCI-H292 Human Lung Cancer Cells In Vitro. In Vivo. 2022 Mar-Apr;36(2):582-595. doi: 10.21873/invivo.12741. | Click |
| 4 | γ-tocotrienol enhances the chemosensitivity of human oral cancer cells to docetaxel through the downregulation of the expression of NF-κB-regulated anti-apoptotic gene products. Int J Oncol. 2013;42(1):75-82. doi:10.3892/ijo.2012.1692 through the downregulation of the expression of NF-κB-regulated anti-apoptotic gene products. Int J Oncol. 2013;42(1):75-82. doi:10.3892/ijo.2012.1692 | Click |
| 5 | Ginsenoside RG1 augments doxorubicin-induced apoptotic cell death in MDA-MB-231 breast cancer cell lines. J Biochem Mol Toxicol. 2022 Jan;36(1):e22945. doi: 10.1002/jbt.22945. | Click |
| 6 | Indole-3-Carbinol (I3C) enhances the sensitivity of murine breast adenocarcinoma cells to doxorubicin (DOX) through inhibition of NF-κβ, blocking angiogenesis and regulation of mitochondrial apoptotic pathway. Chem Biol Interact. 2018 Jun 25;290:19-36. doi: 10.1016/j.cbi.2018.05.005. | Click |
| 7 | Cepharanthine hydrochloride reverses the mdr1 (P-glycoprotein)-mediated esophageal squamous cell carcinoma cell cisplatin resistance through JNK and p53 signals. Oncotarget. 2017 Nov 27;8(67):111144-111160. doi: 10.18632/oncotarget.22676. | Click |
