| Name | Tumor protein p73 | ||
| UniProt ID | P73_HUMAN | ||
| Gene Name | TP73 | ||
| Gene ID | 7161 | ||
| Synonyms |
TP73, CILD47, P73
|
||
| Sequence |
MAQSTATSPDGGTTFEHLWSSLEPDSTYFDLPQSSRGNNEVVGGTDSSMDVFHLEGMTTS
VMAQFNLLSSTMDQMSSRAASASPYTPEHAASVPTHSPYAQPSSTFDTMSPAPVIPSNTD YPGPHHFEVTFQQSSTAKSATWTYSPLLKKLYCQIAKTCPIQIKVSTPPPPGTAIRAMPV YKKAEHVTDVVKRCPNHELGRDFNEGQSAPASHLIRVEGNNLSQYVDDPVTGRQSVVVPY EPPQVGTEFTTILYNFMCNSSCVGGMNRRPILIIITLEMRDGQVLGRRSFEGRICACPGR DRKADEDHYREQQALNESSAKNGAASKRAFKQSPPAVPALGAGVKKRRHGDEDTYYLQVR GRENFEILMKLKESLELMELVPQPLVDSYRQQQQLLQRPSHLQPPSYGPVLSPMNKVHGG MNKLPSVNQLVGQPPPHSSAATPNLGPVGPGMLNNHGHAVPANGEMSSSHSAQSMVSGSH CTPPPPYHADPSLVSFLTGLGCPNCIEYFTSQGLQSIYHLQNLTIEDLGALKIPEQYRMT IWRGLQDLKQGHDYSTAQQLLRSSNAATISIGGSGELQRQRVMEAVHFRVRHTITIPNRG GPGGGPDEWADFGFDLPDCKARKQPIKEEFTEAEIH |
||
| Pathway Map | MAP LINK | ||
| KEGG ID | hsa7161 | ||
| Pfam | PF00536; PF00870; PF07647; PF07710 | ||
| Pair Name | Beta-Cryptoxanthin, Oxaliplatin | |||
| Phytochemical Name | Beta-Cryptoxanthin | |||
| Anticancer drug Name | Oxaliplatin | |||
| Disease Info | [ICD-11: 2B90] | Colon cancer | Investigative | |
| Regulate Info | Down-regulation | Tumor protein p73 | Expression | |
| Result | We propose a putative novel therapeutic strategy for the treatment of colon cancer based on the combination of β-cryptoxanthin and oxaliplatin. The combined regimen produced more benefit than either individual modality without increasing side effects. In addition, the concentration-limiting toxicity of oxaliplatin is reduced in the presence of the carotenoid. | |||
| Pair Name | Mahanine, Fluorouracil | |||
| Phytochemical Name | Mahanine | |||
| Anticancer drug Name | Fluorouracil | |||
| Disease Info | [ICD-11: 2B90] | Colon cancer | Investigative | |
| Regulate Info | Down-regulation | Tumor protein p73 | Expression | |
| Result | Mahanine synergistically enhances cytotoxicity of 5-fluorouracil through ROS-mediated activation of PTEN and p53/p73 in colon carcinoma. | |||
| Pair Name | Carnosic acid, Tamoxifen | |||
| Phytochemical | Carnosic acid | |||
| Drug | Tamoxifen | |||
| Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
| Regulate Info | Up-regulation | Tumor protein p73 | Expression | |
| Result | Our study supplies a novel therapeutic strategy to induce apoptosis for suppressing breast cancer, which was relied on Caspase-3/TRAIL activation. | |||
| No. | Title | Href |
|---|---|---|
| 1 | β-Cryptoxanthin Synergistically Enhances the Antitumoral Activity of Oxaliplatin through ΔNP73 Negative Regulation in Colon Cancer. Clin Cancer Res. 2015 Oct 1;21(19):4398-409. doi: 10.1158/1078-0432.CCR-14-2027. | Click |
| 2 | Mahanine synergistically enhances cytotoxicity of 5-fluorouracil through ROS-mediated activation of PTEN and p53/p73 in colon carcinoma. Apoptosis. 2024 Feb 28. doi: 10.1007/s10495-024-01951-8. | Click |
| 3 | Carnosic acid cooperates with tamoxifen to induce apoptosis associated with Caspase-3 activation in breast cancer cells in vitro and in vivo. Biomed Pharmacother. 2017 May;89:827-837. doi: 10.1016/j.biopha.2017.01.084. | Click |
