Name | Cystine/glutamate transporter | ||
UniProt ID | XCT_HUMAN | ||
Gene Name | SLC7A11 | ||
Gene ID | 23657 | ||
Synonyms |
SLC7A11, CCBR1, xCT
|
||
Sequence |
MVRKPVVSTISKGGYLQGNVNGRLPSLGNKEPPGQEKVQLKRKVTLLRGVSIIIGTIIGA
GIFISPKGVLQNTGSVGMSLTIWTVCGVLSLFGALSYAELGTTIKKSGGHYTYILEVFGP LPAFVRVWVELLIIRPAATAVISLAFGRYILEPFFIQCEIPELAIKLITAVGITVVMVLN SMSVSWSARIQIFLTFCKLTAILIIIVPGVMQLIKGQTQNFKDAFSGRDSSITRLPLAFY YGMYAYAGWFYLNFVTEEVENPEKTIPLAICISMAIVTIGYVLTNVAYFTTINAEELLLS NAVAVTFSERLLGNFSLAVPIFVALSCFGSMNGGVFAVSRLFYVASREGHLPEILSMIHV RKHTPLPAVIVLHPLTMIMLFSGDLDSLLNFLSFARWLFIGLAVAGLIYLRYKCPDMHRP FKVPLFIPALFSFTCLFMVALSLYSDPFSTGIGFVITLTGVPAYYLFIIWDKKPRWFRIM SEKITRTLQIILEVVPEEDKL |
||
Pathway Map | MAP LINK | ||
T.C. Number | 2.A.3.8.18 | ||
KEGG ID | hsa23657 | ||
TTD ID | T11615 | ||
Pfam | PF00324; PF13520; PF13564 |
Pair Name | Beta-Elemene, Cetuximab | |||
Phytochemical | Beta-Elemene | |||
Drug | Cetuximab | |||
Disease Info | [ICD-11: 2B91] | Colorectal cancer | Investigative | |
Regulate Info | Down-regulation | Cystine/glutamate transporter | Expression | |
Result | natural product β-elemene is a new ferroptosis inducer and combinative treatment of β-elemene and cetuximab is sensitive to KRAS mutant CRC cells by inducing ferroptosis and inhibiting EMT, which will hopefully provide a prospective strategy for CRC patients with RAS mutations. |
Pair Name | Camptothecin, Sorafenib | |||
Phytochemical | Camptothecin | |||
Drug | Sorafenib | |||
Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
Regulate Info | Down-regulation | Cystine/glutamate transporter | Expression | |
Result | The synergetic combination significantly increases lipid peroxidation and iron concentration, decreases TAC, GPX4 and GR activity, and reduces the expression of both Nrf2 and SLC7A11. The downregulation of Nrf2 expression has a vital role in the reduction of resistance mediators to sorafenib against HCC cells like (p62, MT1G, and ABCG2) and improves the cellular uptake of sorafenib. The current study provided evidence that Nrf2 inhibition by CPT improves sorafenib's sensitivity and reduces sorafenib's resistance via the augmentation of sorafenib's ferroptosis action. |
Pair Name | Dihydroartemisinin, Sorafenib | |||
Phytochemical | Dihydroartemisinin | |||
Drug | Sorafenib | |||
Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
Regulate Info | Down-regulation | Cystine/glutamate transporter | Expression | |
Result | DHA and Sora had the same mechanism, and the combined application of them could have a synergistic anti-tumor effect by inducing ferroptosis and inhibiting energy metabolism in HepG2 cells. |
Pair Name | Hederagenin, Cisplatin | |||
Phytochemical | Hederagenin | |||
Drug | Cisplatin | |||
Disease Info | Head and neck cancer | |||
Regulate Info | Down-regulation | Cystine/glutamate transporter | Expression | |
Result | Hederagenin effectively targets cisplatin-resistant HNC cells in vitro and in vivo. Consistent with its effects in other types of cancer, hederagenin markedly induces apoptosis in HNC cells by activating the mitochondria-driven intrinsic apoptotic pathway. We demonstrated that the apoptosis-inducing effects of hederagenin are mediated by the inhibition of the Nrf2-ARE antioxidant pathway. |
Pair Name | Ursolic acid, Sorafenib | |||
Phytochemical | Ursolic acid | |||
Drug | Sorafenib | |||
Disease Info | [ICD-11: 2A00-2F9Z] | Solid tumour or cancer | Investigative | |
Regulate Info | Down-regulation | Cystine/glutamate transporter | Expression | |
Result | These results suggest that the synergistic antitumor effects of sorafenib combined with ursolic acid may involve the induction of Mcl-1-related apoptosis and SLC7A11-dependent ferroptosis. Our findings may offer a novel effective therapeutic strategy for tumor treatment. |
Pair Name | Vitamin C, Erastin | |||
Phytochemical | Vitamin C | |||
Drug | Erastin | |||
Disease Info | [ICD-11: 2C10] | Pancreatic cancer | Investigative | |
Regulate Info | Down-regulation | Cystine/glutamate transporter | Expression | |
Result | The combination of erastin and vitamin C exerts a synergistic effect of classical and nonclassical modes to induce ferroptosis in PC cells, which may provide a promising therapeutic strategy for PC. |
Pair Name | Zerumbone, Gefitinib | |||
Phytochemical | Zerumbone | |||
Drug | Gefitinib | |||
Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
Regulate Info | Down-regulation | Cystine/glutamate transporter | Expression | |
Result | Our study suggested that zerumbone combined with gefitinib could effectively inhibit lung cancer for multi-model therapies, including the inhibition of tumor growth, angiogenesis, induce cell apoptosis, and ferroptosis. |
Pair Name | 2,3,5,6-Tetramethylpyrazine, Cisplatin | |||
Phytochemical | 2,3,5,6-Tetramethylpyrazine | |||
Drug | Cisplatin | |||
Disease Info | [ICD-11: 2C10] | Pancreatic cancer | Investigative | |
Regulate Info | Down-regulation | Cystine/glutamate transporter | Expression | |
Result | A series of ligustrazine-derived chalcones-modified platinum(IV) complexes were synthesized and evaluated for their anti-proliferative potency and generated an optimal platinum(IV) complex 16a. The above-described results indicated that 16a obtained different anti-cancer mechanisms of CDDP, which could initiate mitochondria-dependent apoptosis and xCT-GPX4 axial-mediated ferroptosis in PANC-1/CDDP cells. |
No. | Title | Href |
---|---|---|
1 | Combinative treatment of β-elemene and cetuximab is sensitive to KRAS mutant colorectal cancer cells by inducing ferroptosis and inhibiting epithelial-mesenchymal transformation. Theranostics. 2020;10(11):5107-5119. Published 2020 Apr 6. doi:10.7150/thno.44705 | Click |
2 | Camptothecin Sensitizes Hepatocellular Carcinoma Cells to Sorafenib- Induced Ferroptosis Via Suppression of Nrf2. Inflammation. 2023 Aug;46(4):1493-1511. doi: 10.1007/s10753-023-01823-4. | Click |
3 | Dihydroartemisinin enhances the inhibitory effect of sorafenib on HepG2 cells by inducing ferroptosis and inhibiting energy metabolism. J Pharmacol Sci. 2022 Jan;148(1):73-85. doi: 10.1016/j.jphs.2021.09.008. | Click |
4 | Hederagenin Induces Apoptosis in Cisplatin-Resistant Head and Neck Cancer Cells by Inhibiting the Nrf2-ARE Antioxidant Pathway. Oxid Med Cell Longev. 2017;2017:5498908. doi:10.1155/2017/5498908 | Click |
5 | Ursolic acid enhances the antitumor effects of sorafenib associated with Mcl-1-related apoptosis and SLC7A11-dependent ferroptosis in human cancer. Pharmacol Res. 2022 Aug;182:106306. doi: 10.1016/j.phrs.2022.106306. | Click |
6 | Vitamin C Sensitizes Pancreatic Cancer Cells to Erastin-Induced Ferroptosis by Activating the AMPK/Nrf2/HMOX1 Pathway. Oxid Med Cell Longev. 2022 Jul 19;2022:5361241. doi: 10.1155/2022/5361241. | Click |
7 | Zerumbone combined with gefitinib alleviates lung cancer cell growth through the AKT/STAT3/SLC7A11 axis. Neoplasma. 2023 Feb;70(1):58-70. doi: 10.4149/neo_2022_220418N423. | Click |
8 | Ligustrazine-Derived Chalcones-Modified Platinum(IV) Complexes Intervene in Cisplatin Resistance in Pancreatic Cancer through Ferroptosis and Apoptosis. J Med Chem. 2023 Oct 12;66(19):13587-13606. doi: 10.1021/acs.jmedchem.3c00922. | Click |