Name | Solute carrier family 2 | ||
UniProt ID | GTR1_HUMAN | ||
Gene Name | SLC2A1 | ||
Gene ID | 6513 | ||
Synonyms |
SLC2A1, CSE, DYT17, DYT18, DYT9, EIG12, GLUT, GLUT-1, GLUT1, GLUT1DS, HTLVR, PED, SDCHCN
|
||
Sequence |
MEPSSKKLTGRLMLAVGGAVLGSLQFGYNTGVINAPQKVIEEFYNQTWVHRYGESILPTT
LTTLWSLSVAIFSVGGMIGSFSVGLFVNRFGRRNSMLMMNLLAFVSAVLMGFSKLGKSFE MLILGRFIIGVYCGLTTGFVPMYVGEVSPTALRGALGTLHQLGIVVGILIAQVFGLDSIM GNKDLWPLLLSIIFIPALLQCIVLPFCPESPRFLLINRNEENRAKSVLKKLRGTADVTHD LQEMKEESRQMMREKKVTILELFRSPAYRQPILIAVVLQLSQQLSGINAVFYYSTSIFEK AGVQQPVYATIGSGIVNTAFTVVSLFVVERAGRRTLHLIGLAGMAGCAILMTIALALLEQ LPWMSYLSIVAIFGFVAFFEVGPGPIPWFIVAELFSQGPRPAAIAVAGFSNWTSNFIVGM CFQYVEQLCGPYVFIIFTVLLVLFFIFTYFKVPETKGRTFDEIASGFRQGGASQSDKTPE ELFHPLGADSQV |
||
Pathway Map | MAP LINK | ||
T.C. Number | 2.A.1.1.28 | ||
KEGG ID | hsa6513 | ||
TTD ID | T89458 | ||
Pfam | PF00083; PF03092; PF03137; PF07690 |
Pair Name | Cryptotanshinone, Arsenic Trioxid | |||
Phytochemical | Cryptotanshinone | |||
Drug | Arsenic Trioxid | |||
Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
Regulate Info | Down-regulation | Solute carrier family 2 | Expression | |
Result | The therapeutic potential of ACCS as a candidate option for anticancer drugs in restoring the balance of immunity and metabolism deserves further investigation. |
Pair Name | Rhizoma Paridis saponins, Sorafenib | |||
Phytochemical | Rhizoma Paridis saponins | |||
Drug | Sorafenib | |||
Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
Regulate Info | Down-regulation | Solute carrier family 2 | Expression | |
Result | All of that provided possibility to overcome the intolerance of sorafenib by drug compatibility through protection against mitochondria damage, inhibition of anaerobic glycolysis and suppression of lipid synthesis based on PI3K/Akt/mTOR pathway. |
Pair Name | Ursolic acid, Doxorubicin | |||
Phytochemical | Ursolic acid | |||
Drug | Doxorubicin | |||
Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
Regulate Info | Down-regulation | Solute carrier family 2 | Expression | |
Result | Ursolic acid augments the chemosensitivity of drug-resistant breast cancer cells to doxorubicin by AMPK-mediated mitochondrial dysfunction |
Pair Name | Vitamin C, Erastin | |||
Phytochemical | Vitamin C | |||
Drug | Erastin | |||
Disease Info | [ICD-11: 2C10] | Pancreatic cancer | Investigative | |
Regulate Info | Up-regulation | Solute carrier family 2 | Expression | |
Result | The combination of erastin and vitamin C exerts a synergistic effect of classical and nonclassical modes to induce ferroptosis in PC cells, which may provide a promising therapeutic strategy for PC. |
Pair Name | Vitamin C, Oxaliplatin | |||
Phytochemical | Vitamin C | |||
Drug | Oxaliplatin | |||
Disease Info | [ICD-11: 2B72] | Gastric cancer | Investigative | |
Regulate Info | Down-regulation | Solute carrier family 2 | Expression | |
Result | The current study showed that GLUT1 expression was inversely correlated with sensitivity of gastric cancer cells to pharmacological ascorbate and suggested that GLUT1 expression in gastric cancer may serve as a marker for sensitivity to pharmacological ascorbate. |
Pair Name | Saikosaponin D, Gefitinib | |||
Phytochemical | Saikosaponin D | |||
Drug | Gefitinib | |||
Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
Regulate Info | Down-regulation | Solute carrier family 2 | Expression | |
Result | Saikosaponin D enhances the antitumor effect of gemcitabine by controlling glucose metabolism and drug efflux by inhibiting the ADRB2 signaling. Therefore, the combination of saikosaponin D and gemcitabine may be a potential therapeutic strategy for the treatment of iCCA. |
Pair Name | Saikosaponin D, Gefitinib | |||
Phytochemical | Saikosaponin D | |||
Drug | Gefitinib | |||
Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
Regulate Info | Down-regulation | Solute carrier family 2 | Expression | |
Result | Saikosaponin D enhances the antitumor effect of gemcitabine by controlling glucose metabolism and drug efflux by inhibiting the ADRB2 signaling. Therefore, the combination of saikosaponin D and gemcitabine may be a potential therapeutic strategy for the treatment of iCCA. |
Pair Name | Shikonin, Gemcitabine | |||
Phytochemical | Shikonin | |||
Drug | Gemcitabine | |||
Disease Info | [ICD-11: 2C10] | Pancreatic cancer | Investigative | |
Regulate Info | Down-regulation | Solute carrier family 2 | Expression | |
Result | These results indicate that shikonin reduced MCT4 expression and activation, resulting in inhibition of aerobic glycolysis in CAFs and overcoming CAF-induced gemcitabine resistance in PC. Shikonin is a promising chemosensitizing phytochemical agent when used in combination with gemcitabine for PC treatment. The results suggest that disrupting the metabolic coupling between cancer cells and stromal cells might provide an attractive strategy for improving gemcitabine efficacy. |
No. | Title | Href |
---|---|---|
1 | Arsenic Trioxide Cooperate Cryptotanshinone Exerts Antitumor Effect by Medicating Macrophage Polarization through Glycolysis. J Immunol Res. 2022 Feb 8;2022:2619781. doi: 10.1155/2022/2619781. | Click |
2 | Combinatorial treatment of Rhizoma Paridis saponins and sorafenib overcomes the intolerance of sorafenib. J Steroid Biochem Mol Biol. 2018 Oct;183:159-166. doi: 10.1016/j.jsbmb.2018.06.010. | Click |
3 | Ursolic acid augments the chemosensitivity of drug-resistant breast cancer cells to doxorubicin by AMPK-mediated mitochondrial dysfunction. Biochem Pharmacol. 2022 Nov;205:115278. doi: 10.1016/j.bcp.2022.115278. | Click |
4 | Vitamin C Sensitizes Pancreatic Cancer Cells to Erastin-Induced Ferroptosis by Activating the AMPK/Nrf2/HMOX1 Pathway. Oxid Med Cell Longev. 2022 Jul 19;2022:5361241. doi: 10.1155/2022/5361241. | Click |
5 | Pharmacological Ascorbate Suppresses Growth of Gastric Cancer Cells with GLUT1 Overexpression and Enhances the Efficacy of Oxaliplatin Through Redox Modulation. Theranostics. 2018 Feb 2;8(5):1312-1326. doi: 10.7150/thno.21745. | Click |
6 | Saikosaponin D reverses epinephrine- and norepinephrine-induced gemcitabine resistance in intrahepatic cholangiocarcinoma by downregulating ADRB2/glycolysis signaling. Acta Biochim Biophys Sin (Shanghai). 2023 Jul 25;55(9):1404-1414. doi: 10.3724/abbs.2023040. | Click |
7 | Saikosaponin D reverses epinephrine- and norepinephrine-induced gemcitabine resistance in intrahepatic cholangiocarcinoma by downregulating ADRB2/glycolysis signaling. Acta Biochim Biophys Sin (Shanghai). 2023 Jul 25;55(9):1404-1414. doi: 10.3724/abbs.2023040. | Click |
8 | Shikonin reverses cancer-associated fibroblast-induced gemcitabine resistance in pancreatic cancer cells by suppressing monocarboxylate transporter 4-mediated reverse Warburg effect. Phytomedicine. 2024 Jan;123:155214. doi: 10.1016/j.phymed.2023.155214. | Click |