
| Name | POU domain, class 5, transcription factor 1 | ||
| UniProt ID | PO5F1_HUMAN | ||
| Gene Name | POU5F1 | ||
| Gene ID | 5460 | ||
| Synonyms |
POU5F1, OCT3, OCT4, OTF-3, OTF3, OTF4, Oct-3, Oct-4, Oct3/4
|
||
| Sequence |
MAGHLASDFAFSPPPGGGGDGPGGPEPGWVDPRTWLSFQGPPGGPGIGPGVGPGSEVWGI
PPCPPPYEFCGGMAYCGPQVGVGLVPQGGLETSQPEGEAGVGVESNSDGASPEPCTVTPG AVKLEKEKLEQNPEESQDIKALQKELEQFAKLLKQKRITLGYTQADVGLTLGVLFGKVFS QTTICRFEALQLSFKNMCKLRPLLQKWVEEADNNENLQEICKAETLVQARKRKRTSIENR VRGNLENLFLQCPKPTLQQISHIAQQLGLEKDVVRVWFCNRRQKGKRSSSDYAQREDFEA AGSPFSGGPVSFPLAPGPHFGTPGYGSPHFTALYSSVPFPEGEAFPPVSVTTLGSPMHSN |
||
| Pathway Map | MAP LINK | ||
| KEGG ID | hsa5460 | ||
| Pfam | PF00046; PF00157; PF04412; PF05920; PF17943 | ||
| Pair Name | Berbamine, Arcyriaflavin A | |||
| Phytochemical | Berbamine | |||
| Drug | Arcyriaflavin A | |||
| Disease Info | [ICD-11: 2A00] | Glioblastoma multiforme | Investigative | |
| Regulate Info | Down-regulation | POU domain, class 5, transcription factor 1 | Expression | |
| Result | Our findings suggest that a novel combination therapy involving berbamine and ArcA could effectively eradicate glioblastoma stem-like cells. | |||
| Pair Name | Kaempferol, Verapamil | |||
| Phytochemical | Kaempferol | |||
| Drug | Verapamil | |||
| Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
| Regulate Info | Down-regulation | POU domain, class 5, transcription factor 1 | Expression | |
| Result | Deregulation of the CD44-NANOG-MDR1 associated chemoresistance pathways of breast cancer stem cells potentiates the anti-cancer effect of Kaempferol in synergism with Verapamil | |||
| Pair Name | Shikonin, BEZ235 | |||
| Phytochemical | Shikonin | |||
| Drug | BEZ235 | |||
| Disease Info | [ICD-11: 2C25.Z] | Lung cancer | Investigative | |
| Regulate Info | Down-regulation | POU domain, class 5, transcription factor 1 | Expression | |
| Result | We found that low doses shikonin and dual PI3K-mTOR inhibitor (BEZ235) have a synergistic effect that inhibits the spheroid formation from chemoresistant lung cancer sublines. Inhibiting the proliferation of lung cancer stem cells is believed to reduce the recurrence of lung cancer; therefore, shikonin's anti-drug resistance and anti-cancer stem cell activities make it a highly interesting molecule for future combined lung cancer therapy. | |||
| Pair Name | Sulforaphane, Acetazolamide | |||
| Phytochemical | Sulforaphane | |||
| Drug | Acetazolamide | |||
| Disease Info | [ICD-11: 2C25.Z] | Lung cancer | Investigative | |
| Regulate Info | Down-regulation | POU domain, class 5, transcription factor 1 | Expression | |
| Result | Human bronchial carcinoid tumor cells serially passaged as spheroids contain a higher fraction of TIC exhibiting a stemness phenotype. This TIC population can be effectively targeted by the combination of AZ + SFN. Our work portends clinical relevance and supports the therapeutic use of the novel AZ+ SFN combination that may target the TIC population of bronchial carcinoids. | |||
| Pair Name | Brassinolid, Doxorubicin | |||
| Phytochemical | Brassinolid | |||
| Drug | Doxorubicin | |||
| Disease Info | [ICD-11: 2C25.Z] | Lung cancer | Investigative | |
| Regulate Info | Up-regulation | POU domain, class 5, transcription factor 1 | Expression | |
| Result | These data indicate that EB, a natural product with widespread occurrence in plants, is pharmacologically active in both drug-sensitive and drug-resistant SCLC cells and acts through the Wnt signaling pathway. | |||
| No. | Title | Href |
|---|---|---|
| 1 | Synergistic Anticancer Effect of a Combination of Berbamine and Arcyriaflavin A against Glioblastoma Stem-like Cells. Molecules. 2022 Nov 17;27(22):7968. doi: 10.3390/molecules27227968. | Click |
| 2 | Deregulation of the CD44-NANOG-MDR1 associated chemoresistance pathways of breast cancer stem cells potentiates the anti-cancer effect of Kaempferol in synergism with Verapamil. Toxicol Appl Pharmacol. 2022 Feb 15;437:115887. doi: 10.1016/j.taap.2022.115887. | Click |
| 3 | Attenuation of PI3K-Akt-mTOR Pathway to Reduce Cancer Stemness on Chemoresistant Lung Cancer Cells by Shikonin and Synergy with BEZ235 Inhibitor. Int J Mol Sci. 2024 Jan 3;25(1):616. doi: 10.3390/ijms25010616. | Click |
| 4 | Human bronchial carcinoid tumor initiating cells are targeted by the combination of acetazolamide and sulforaphane. BMC Cancer. 2019 Aug 30;19(1):864. doi: 10.1186/s12885-019-6018-1. | Click |
| 5 | The effect of brassinolide, a plant steroid hormone, on drug resistant small-cell lung carcinoma cells. Biochem Biophys Res Commun. 2017 Nov 4;493(1):783-787. doi: 10.1016/j.bbrc.2017.08.094. | Click |