TOP
Nav Bar
  1. General Info
  2. Effects Info
  3. Reference
Molecular Details
01. General Information
Name Phorbol-12-myristate-13-acetate-induced protein 1
UniProt ID APR_HUMAN
Gene Name PMAIP1
Gene ID 5366
Synonyms
PMAIP1, APR, NOXA
Sequence
MPGKKARKNAQPSPARAPAELEVECATQLRRFGDKLNFRQKLLNLISKLFCSGT
Pathway Map MAP LINK
KEGG ID hsa5366
Pfam PF15150
02. Combinatorial Therapeutic Effect(s)
Synergistic Effect
Hide/Show
Enhancing Drug Efficacy
Hide/Show
Combination Pair ID: 157
Pair Name Triptolide, ABT-199
Phytochemical Triptolide
Drug ABT-199
Disease Info [ICD-11: 2A60.Z] Acute myeloid leukemia Investigative
Regulate Info Up-regulation Phorbol-12-myristate-13-acetate-induced protein 1 Expression
Result These findings suggest that the regimen combining TPL and ABT-199 might be active against AML by inducing robust apoptosis through reciprocal regulation of anti- and proapoptotic Bcl-2 family proteins, therefore providing a strong rationale for the clinical investigation of this combination regimen for the treatment of AML.
Combination Pair ID: 409
Pair Name Luteolin, Paclitaxel
Phytochemical Luteolin
Drug Paclitaxel
Disease Info [ICD-11: 2B70] Esophageal cancer Investigative
Regulate Info Up-regulation Phorbol-12-myristate-13-acetate-induced protein 1 Expression
Result The molecular mechanism of inhibiting cell migration and EMT processes may be related to the inhibition of SIRT1, and the mechanism of apoptosis induction is associated with the reactive oxygen species (ROS)/c-Jun N-terminal kinase (JNK) pathway-mediated activation of mitochondrial apoptotic pathway.
Combination Pair ID: 454
Pair Name Mangiferin, Doxorubicin
Phytochemical Mangiferin
Drug Doxorubicin
Disease Info [ICD-11: 2A83.1] Multiple myeloma Investigative
Regulate Info Up-regulation Phorbol-12-myristate-13-acetate-induced protein 1 Expression
Result Our findings suggest that the combination of mangiferin and an anticancer drug could be used as a new regime for the treatment of MM.
Combination Pair ID: 605
Pair Name Phenethyl isothiocyanate, Gefitinib
Phytochemical Phenethyl isothiocyanate
Drug Gefitinib
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Down-regulation Phorbol-12-myristate-13-acetate-induced protein 1 Expression
Result We explored the prospect of PEITC in improving the efficacy of targeted drug therapy and demonstrated the synergistic effects and underlined mechanisms of PEITC combined with Gefitinib in NSCLC cells treatment. This study provided useful information for developing novel therapy strategies by combination treatment of PEITC with targeted drugs.
Reversing Drug Resistance
Hide/Show
Combination Pair ID: 172
Pair Name Artesunate, Venetoclax
Phytochemical Artesunate
Drug Venetoclax
Disease Info [ICD-11: 2A60.Z] Acute myeloid leukemia Investigative
Regulate Info Down-regulation Phorbol-12-myristate-13-acetate-induced protein 1 Expression
Result We provide a new triple combination for AML treatment by targeting the Noxa/Mcl-1/Bim axis to reverse Mcl-1/p-Chk1 resistance of cytarabine therapy.
Combination Pair ID: 316
Pair Name Honokiol, Paclitaxel
Phytochemical Honokiol
Drug Paclitaxel
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation Phorbol-12-myristate-13-acetate-induced protein 1 Expression
Result Synergistic killing effect of paclitaxel and honokiol in non-small cell lung cancer cells through paraptosis induction
Combination Pair ID: 877
Pair Name Gossypol, Gemcitabine
Phytochemical Gossypol
Drug Gemcitabine
Disease Info [ICD-11: 2A00-2F9Z] Solid tumour or cancer Investigative
Regulate Info Up-regulation Phorbol-12-myristate-13-acetate-induced protein 1 Expression
Result Combination therapy with gossypol reveals synergism against gemcitabine resistance in cancer cells with high BCL-2 expression
03. Reference
No. Title Href
1 Combining triptolide with ABT-199 is effective against acute myeloid leukemia through reciprocal regulation of Bcl-2 family proteins and activation of the intrinsic apoptotic pathway. Cell Death Dis. 2020 Jul 22;11(7):555. doi: 10.1038/s41419-020-02762-w. Click
2 Luteolin combined with low-dose paclitaxel synergistically inhibits epithelial-mesenchymal transition and induces cell apoptosis on esophageal carcinoma in vitro and in vivo. Phytother Res. 2021 Nov;35(11):6228-6240. doi: 10.1002/ptr.7267. Click
3 Mangiferin enhances the sensitivity of human multiple myeloma cells to anticancer drugs through suppression of the nuclear factor κB pathway. Int J Oncol. 2016 Jun;48(6):2704-12. doi: 10.3892/ijo.2016.3470. Click
4 Phenethyl isothiocyanate synergistically induces apoptosis with Gefitinib in non-small cell lung cancer cells via endoplasmic reticulum stress-mediated degradation of Mcl-1. Mol Carcinog. 2020 Jun;59(6):590-603. doi: 10.1002/mc.23184. Click
5 Artesunate improves venetoclax plus cytarabine AML cell targeting by regulating the Noxa/Bim/Mcl-1/p-Chk1 axis. Cell Death Dis. 2022 Apr 20;13(4):379. doi: 10.1038/s41419-022-04810-z. Click
6 Synergistic killing effect of paclitaxel and honokiol in non-small cell lung cancer cells through paraptosis induction. Cell Oncol (Dordr). 2021 Feb;44(1):135-150. doi: 10.1007/s13402-020-00557-x. Click
7 Combination therapy with gossypol reveals synergism against gemcitabine resistance in cancer cells with high BCL-2 expression. PLoS One. 2012;7(12):e50786. doi: 10.1371/journal.pone.0050786. Click
It has been 177317 visits since 2024.08
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang
TOP