
| Name | Homeobox protein NANOG | ||
| UniProt ID | NANOG_HUMAN | ||
| Gene Name | NANOG | ||
| Gene ID | 79923 | ||
| Synonyms |
NANOG
|
||
| Sequence |
MSVDPACPQSLPCFEASDCKESSPMPVICGPEENYPSLQMSSAEMPHTETVSPLPSSMDL
LIQDSPDSSTSPKGKQPTSAEKSVAKKEDKVPVKKQKTRTVFSSTQLCVLNDRFQRQKYL SLQQMQELSNILNLSYKQVKTWFQNQRMKSKRWQKNNWPKNSNGVTQKASAPTYPSLYSS YHQGCLVNPTGNLPMWSNQTWNNSTWSNQTQNIQSWSNHSWNTQTWCTQSWNNQAWNSPF YNCGEESLQSCMQFQPNSPASDLEAALEAAGEGLNVIQQTTRYFSTPQTMDLFLNYSMNM QPEDV |
||
| Pathway Map | MAP LINK | ||
| KEGG ID | hsa79923 | ||
| Pfam | PF00046 | ||
| Pair Name | Berbamine, Arcyriaflavin A | |||
| Phytochemical | Berbamine | |||
| Drug | Arcyriaflavin A | |||
| Disease Info | [ICD-11: 2A00] | Glioblastoma multiforme | Investigative | |
| Regulate Info | Down-regulation | Homeobox protein NANOG | Expression | |
| Result | Our findings suggest that a novel combination therapy involving berbamine and ArcA could effectively eradicate glioblastoma stem-like cells. | |||
| Pair Name | Kaempferol, Verapamil | |||
| Phytochemical | Kaempferol | |||
| Drug | Verapamil | |||
| Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
| Regulate Info | Down-regulation | Homeobox protein NANOG | Expression | |
| Result | Deregulation of the CD44-NANOG-MDR1 associated chemoresistance pathways of breast cancer stem cells potentiates the anti-cancer effect of Kaempferol in synergism with Verapamil | |||
| Pair Name | Silibinin, Sorafenib | |||
| Phytochemical | Silibinin | |||
| Drug | Sorafenib | |||
| Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
| Regulate Info | Down-regulation | Homeobox protein NANOG | Expression | |
| Result | These results suggested that silibinin improved the efficacy of sorafenib in HCC therapy, indicating a clinical promising therapeutic strategy for HCC patients. | |||
| Pair Name | Shikonin, BEZ235 | |||
| Phytochemical | Shikonin | |||
| Drug | BEZ235 | |||
| Disease Info | [ICD-11: 2C25.Z] | Lung cancer | Investigative | |
| Regulate Info | Down-regulation | Homeobox protein NANOG | Expression | |
| Result | We found that low doses shikonin and dual PI3K-mTOR inhibitor (BEZ235) have a synergistic effect that inhibits the spheroid formation from chemoresistant lung cancer sublines. Inhibiting the proliferation of lung cancer stem cells is believed to reduce the recurrence of lung cancer; therefore, shikonin's anti-drug resistance and anti-cancer stem cell activities make it a highly interesting molecule for future combined lung cancer therapy. | |||
| Pair Name | Curcumin, Cisplatin | |||
| Phytochemical | Curcumin | |||
| Drug | Cisplatin | |||
| Disease Info | [ICD-11: 2C25.Z] | Lung cancer | Investigative | |
| Regulate Info | Down-regulation | Homeobox protein NANOG | Expression | |
| Result | Synergistic Roles of Curcumin in Sensitising the Cisplatin Effect on a Cancer Stem Cell-Like Population Derived from Non-Small Cell Lung Cancer Cell Lines | |||
| Pair Name | Hispidin, Gemcitabine | |||
| Phytochemical | Hispidin | |||
| Drug | Gemcitabine | |||
| Disease Info | [ICD-11: 2C10.Z] | Pancreatic cancer | Investigative | |
| Regulate Info | Down-regulation | Homeobox protein NANOG | Expression | |
| Result | Hispidin might be a novel chemosensitizer for gemcitabine and a potential synergistic agent for increasing the therapeutic index of gemcitabine as a treatment for pancreatic cancer. | |||
| Pair Name | Brassinolid, Doxorubicin | |||
| Phytochemical | Brassinolid | |||
| Drug | Doxorubicin | |||
| Disease Info | [ICD-11: 2C25.Z] | Lung cancer | Investigative | |
| Regulate Info | Down-regulation | Homeobox protein NANOG | Expression | |
| Result | These data indicate that EB, a natural product with widespread occurrence in plants, is pharmacologically active in both drug-sensitive and drug-resistant SCLC cells and acts through the Wnt signaling pathway. | |||
| No. | Title | Href |
|---|---|---|
| 1 | Synergistic Anticancer Effect of a Combination of Berbamine and Arcyriaflavin A against Glioblastoma Stem-like Cells. Molecules. 2022 Nov 17;27(22):7968. doi: 10.3390/molecules27227968. | Click |
| 2 | Deregulation of the CD44-NANOG-MDR1 associated chemoresistance pathways of breast cancer stem cells potentiates the anti-cancer effect of Kaempferol in synergism with Verapamil. Toxicol Appl Pharmacol. 2022 Feb 15;437:115887. doi: 10.1016/j.taap.2022.115887. | Click |
| 3 | Combined treatment with sorafenib and silibinin synergistically targets both HCC cells and cancer stem cells by enhanced inhibition of the phosphorylation of STAT3/ERK/AKT. Eur J Pharmacol. 2018 Aug 5;832:39-49. doi: 10.1016/j.ejphar.2018.05.027. | Click |
| 4 | Attenuation of PI3K-Akt-mTOR Pathway to Reduce Cancer Stemness on Chemoresistant Lung Cancer Cells by Shikonin and Synergy with BEZ235 Inhibitor. Int J Mol Sci. 2024 Jan 3;25(1):616. doi: 10.3390/ijms25010616. | Click |
| 5 | Synergistic Roles of Curcumin in Sensitising the Cisplatin Effect on a Cancer Stem Cell-Like Population Derived from Non-Small Cell Lung Cancer Cell Lines. Molecules. 2021 Feb 18;26(4):1056. doi: 10.3390/molecules26041056. | Click |
| 6 | Combination Effects of Hispidin and Gemcitabine via Inhibition of Stemness in Pancreatic Cancer Stem Cells. Anticancer Res. 2018 Jul;38(7):3967-3975. doi: 10.21873/anticanres.12683. | Click |
| 7 | The effect of brassinolide, a plant steroid hormone, on drug resistant small-cell lung carcinoma cells. Biochem Biophys Res Commun. 2017 Nov 4;493(1):783-787. doi: 10.1016/j.bbrc.2017.08.094. | Click |