
| Name | L-lactate dehydrogenase A chain | ||
| UniProt ID | LDHA_HUMAN | ||
| Gene Name | LDHA | ||
| Gene ID | 3939 | ||
| Synonyms |
LDHA, GSD11, HEL-S-133P, LDHM, PIG19
|
||
| Sequence |
MATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKG
EMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFI IPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGV HPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYE VIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGI SDLVKVTLTSEEEARLKKSADTLWGIQKELQF |
||
| Pathway Map | MAP LINK | ||
| T.C. Number | 3.A.1.1.1; 8.A.72.1.1 | ||
| KEGG ID | hsa3939 | ||
| TTD ID | T15053 | ||
| Pfam | PF00056; PF02056; PF02866; PF11975 | ||
| Pair Name | Chlorogenic acid, Methotrexate | |||
| Phytochemical Name | Chlorogenic acid | |||
| Anticancer drug Name | Methotrexate | |||
| Disease Info | [ICD-11: 2B33.4] | Leukemia | Investigative | |
| Regulate Info | Down-regulation | L-lactate dehydrogenase A chain | Expression | |
| Result | These results imply that CGA has perfective effect against MTX-induced liver injury. Hence CGA supplementation might be helpful in abrogation of MTX toxicity. | |||
| Pair Name | Carvacrol, Sorafenib | |||
| Phytochemical Name | Carvacrol | |||
| Anticancer drug Name | Sorafenib | |||
| Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
| Regulate Info | Down-regulation | L-lactate dehydrogenase A chain | Expression | |
| Result | CARV/Sora is a promising combination for tumor suppression and overcoming Sora resistance and cardiotoxicity in HCC by modulating TRPM7. To our best knowledge, this study represents the first study to investigate the efficiency of CARV/ Sora on the HCC rat model. Moreover, no previous studies have reported the effect of inhibiting TRPM7 on HCC. | |||
| Pair Name | Rhizoma Paridis saponins, Sorafenib | |||
| Phytochemical | Rhizoma Paridis saponins | |||
| Drug | Sorafenib | |||
| Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
| Regulate Info | Down-regulation | L-lactate dehydrogenase A chain | Expression | |
| Result | All of that provided possibility to overcome the intolerance of sorafenib by drug compatibility through protection against mitochondria damage, inhibition of anaerobic glycolysis and suppression of lipid synthesis based on PI3K/Akt/mTOR pathway. | |||
| Pair Name | Cianidanol, Fluorouracil | |||
| Phytochemical | Cianidanol | |||
| Drug | Fluorouracil | |||
| Disease Info | [ICD-11: 2B72.Z] | Gastric cancer | Investigative | |
| Regulate Info | Up-regulation | L-lactate dehydrogenase A chain | Expression | |
| Result | We suggest catechin as a candidate for the development of a novel adjuvant drug that reduces chemoresistance to 5FU by restricting LDHA. | |||
| Pair Name | Shikonin, Gemcitabine | |||
| Phytochemical | Shikonin | |||
| Drug | Gemcitabine | |||
| Disease Info | [ICD-11: 2C10.Z] | Pancreatic cancer | Investigative | |
| Regulate Info | Down-regulation | L-lactate dehydrogenase A chain | Expression | |
| Result | These results indicate that shikonin reduced MCT4 expression and activation, resulting in inhibition of aerobic glycolysis in CAFs and overcoming CAF-induced gemcitabine resistance in PC. Shikonin is a promising chemosensitizing phytochemical agent when used in combination with gemcitabine for PC treatment. The results suggest that disrupting the metabolic coupling between cancer cells and stromal cells might provide an attractive strategy for improving gemcitabine efficacy. | |||
| No. | Title | Href |
|---|---|---|
| 1 | Protective effect of Chlorogenic acid against methotrexate induced oxidative stress, inflammation and apoptosis in rat liver: An experimental approach. Chem Biol Interact. 2017 Jun 25;272:80-91. doi: 10.1016/j.cbi.2017.05.002. | Click |
| 2 | Carvacrol enhances anti-tumor activity and mitigates cardiotoxicity of sorafenib in thioacetamide-induced hepatocellular carcinoma model through inhibiting TRPM7. Life Sci. 2023 Jul 1;324:121735. doi: 10.1016/j.lfs.2023.121735. | Click |
| 3 | Combinatorial treatment of Rhizoma Paridis saponins and sorafenib overcomes the intolerance of sorafenib. J Steroid Biochem Mol Biol. 2018 Oct;183:159-166. doi: 10.1016/j.jsbmb.2018.06.010. | Click |
| 4 | Targeting Lactate Dehydrogenase A with Catechin Resensitizes SNU620/5FU Gastric Cancer Cells to 5-Fluorouracil. Int J Mol Sci. 2021 May 20;22(10):5406. doi: 10.3390/ijms22105406. | Click |
| 5 | Shikonin reverses cancer-associated fibroblast-induced gemcitabine resistance in pancreatic cancer cells by suppressing monocarboxylate transporter 4-mediated reverse Warburg effect. Phytomedicine. 2024 Jan;123:155214. doi: 10.1016/j.phymed.2023.155214. | Click |