TOP
Nav Bar
  1. General Info
  2. Effects Info
  3. Reference
Molecular Details
01. General Information
Name Kelch-like ECH-associated protein 1
UniProt ID KEAP1_HUMAN
Gene Name KEAP1
Gene ID 9817
Synonyms
KEAP1, INrf2, KLHL19
Sequence
MQPDPRPSGAGACCRFLPLQSQCPEGAGDAVMYASTECKAEVTPSQHGNRTFSYTLEDHT
KQAFGIMNELRLSQQLCDVTLQVKYQDAPAAQFMAHKVVLASSSPVFKAMFTNGLREQGM
EVVSIEGIHPKVMERLIEFAYTASISMGEKCVLHVMNGAVMYQIDSVVRACSDFLVQQLD
PSNAIGIANFAEQIGCVELHQRAREYIYMHFGEVAKQEEFFNLSHCQLVTLISRDDLNVR
CESEVFHACINWVKYDCEQRRFYVQALLRAVRCHSLTPNFLQMQLQKCEILQSDSRCKDY
LVKIFEELTLHKPTQVMPCRAPKVGRLIYTAGGYFRQSLSYLEAYNPSDGTWLRLADLQV
PRSGLAGCVVGGLLYAVGGRNNSPDGNTDSSALDCYNPMTNQWSPCAPMSVPRNRIGVGV
IDGHIYAVGGSHGCIHHNSVERYEPERDEWHLVAPMLTRRIGVGVAVLNRLLYAVGGFDG
TNRLNSAECYYPERNEWRMITAMNTIRSGAGVCVLHNCIYAAGGYDGQDQLNSVERYDVE
TETWTFVAPMKHRRSALGITVHQGRIYVLGGYDGHTFLDSVECYDPDTDTWSEVTRMTSG
RSGVGVAVTMEPCRKQIDQQNCTC
Pathway Map MAP LINK
KEGG ID hsa9817
TTD ID T83198
Pfam PF00651; PF01344; PF07646; PF07707; PF13415; PF13418; PF13964; PF21536
02. Combinatorial Therapeutic Effect(s)
Synergistic Effect
Hide/Show
Enhancing Drug Efficacy
Hide/Show
Combination Pair ID: 74
Pair Name Baicalein, Cisplatin
Phytochemical Baicalein
Drug Cisplatin
Disease Info [ICD-11: 2B72.Z] Gastric cancer Investigative
Regulate Info Down-regulation Kelch-like ECH-associated protein 1 Activity
Result Baicalein enhanced cisplatin sensitivity of gastric cancer cells by inducing cell apoptosis and autophagy via Akt/mTOR and Nrf2/Keap 1 pathway
Combination Pair ID: 251
Pair Name Bruceine D, Gemcitabine
Phytochemical Bruceine D
Drug Gemcitabine
Disease Info [ICD-11: 2C10.0] Pancreatic ductal adenocarcinoma Investigative
Regulate Info Down-regulation Kelch-like ECH-associated protein 1 Expression
Result Our experimental findings indicate that BD, a potent Nrf2 inhibitor, holds promise for further development into a novel adjuvant therapy for PDAC.
Combination Pair ID: 483
Pair Name Tiliroside, Sorafenib
Phytochemical Tiliroside
Drug Sorafenib
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Up-regulation Kelch-like ECH-associated protein 1 Expression
Result Our findings imply that tiliroside is a potent TBK1 inhibitor and a candidate natural anti-cancer product that could function as a sensitizer of sorafenib in HCC treatment by targeting TBK1 to induce ferroptosis.
Combination Pair ID: 507
Pair Name Glucosinalbate, Doxorubicin
Phytochemical Glucosinalbate
Drug Doxorubicin
Disease Info [ICD-11: 2C90] Ehrlich ascites carcinoma Investigative
Regulate Info Down-regulation Kelch-like ECH-associated protein 1 Expression
Result The present study clearly suggested therapeutic benefit of I3C in combination with DOX by augmenting anticancer efficacy and diminishing toxicity to the host.
Combination Pair ID: 564
Pair Name Hederagenin, Cisplatin
Phytochemical Hederagenin
Drug Cisplatin
Disease Info Head and neck cancer
Regulate Info Up-regulation Kelch-like ECH-associated protein 1 Expression
Result Hederagenin effectively targets cisplatin-resistant HNC cells in vitro and in vivo. Consistent with its effects in other types of cancer, hederagenin markedly induces apoptosis in HNC cells by activating the mitochondria-driven intrinsic apoptotic pathway. We demonstrated that the apoptosis-inducing effects of hederagenin are mediated by the inhibition of the Nrf2-ARE antioxidant pathway.
Combination Pair ID: 947
Pair Name Phenethyl isothiocyanate, Dasatinib
Phytochemical Phenethyl isothiocyanate
Drug Dasatinib
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Down-regulation Kelch-like ECH-associated protein 1 Expression
Result PEITC showed to enhance dasatinib action in treating HCC with increased production of ROS that induced cell cycle arrest followed by mitotic catastrophe, and to induce oxeiptosis. These results highlight the role that ITCs may have in cancer therapy as a complement of clinically approved chemotherapeutic drugs
Combination Pair ID: 959
Pair Name Periplocin, Gemcitabine
Phytochemical Periplocin
Drug Gemcitabine
Disease Info [ICD-11: 2C10.Z] Pancreatic cancer Investigative
Regulate Info Up-regulation Kelch-like ECH-associated protein 1 Expression
Result Periplocin exerts antitumor activity by regulating Nrf2-mediated signaling pathway in gemcitabine-resistant pancreatic cancer cells
03. Reference
No. Title Href
1 Baicalein enhanced cisplatin sensitivity of gastric cancer cells by inducing cell apoptosis and autophagy via Akt/mTOR and Nrf2/Keap 1 pathway. Biochem Biophys Res Commun. 2020 Oct 20;531(3):320-327. doi: 10.1016/j.bbrc.2020.07.045. Click
2 Brucein D augments the chemosensitivity of gemcitabine in pancreatic cancer via inhibiting the Nrf2 pathway. J Exp Clin Cancer Res. 2022 Mar 10;41(1):90. doi: 10.1186/s13046-022-02270-z. Click
3 Tiliroside targets TBK1 to induce ferroptosis and sensitize hepatocellular carcinoma to sorafenib. Phytomedicine. 2023 Mar;111:154668. doi: 10.1016/j.phymed.2023.154668. Click
4 Indole-3-Carbinol (I3C) enhances the sensitivity of murine breast adenocarcinoma cells to doxorubicin (DOX) through inhibition of NF-κβ, blocking angiogenesis and regulation of mitochondrial apoptotic pathway. Chem Biol Interact. 2018 Jun 25;290:19-36. doi: 10.1016/j.cbi.2018.05.005. Click
5 Hederagenin Induces Apoptosis in Cisplatin-Resistant Head and Neck Cancer Cells by Inhibiting the Nrf2-ARE Antioxidant Pathway. Oxid Med Cell Longev. 2017;2017:5498908. doi:10.1155/2017/5498908 Click
6 Phenethyl isothiocyanate and dasatinib combination synergistically reduces hepatocellular carcinoma growth via cell cycle arrest and oxeiptosis. Front Pharmacol. 2023 Oct 4;14:1264032. doi: 10.3389/fphar.2023.1264032. Click
7 Periplocin exerts antitumor activity by regulating Nrf2-mediated signaling pathway in gemcitabine-resistant pancreatic cancer cells. Biomed Pharmacother. 2023 Jan;157:114039. doi: 10.1016/j.biopha.2022.114039. Click
It has been 523750 visits since 2024.08
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang
TOP