| Name | Heat shock protein HSP 90-alpha | ||
| UniProt ID | HS90A_HUMAN | ||
| Gene Name | HSP90AA1 | ||
| Gene ID | 3320 | ||
| Synonyms |
HSP90AA1, EL52, HEL-S-65p, HSP86, HSP89A, HSP90A, HSP90N, HSPC1, HSPCA, HSPCAL1, HSPCAL4, HSPN, Hsp103, Hsp89, Hsp90, LAP-2, LAP2
|
||
| Sequence |
MPEETQTQDQPMEEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIR
YESLTDPSKLDSGKELHINLIPNKQDRTLTIVDTGIGMTKADLINNLGTIAKSGTKAFME ALQAGADISMIGQFGVGFYSAYLVAEKVTVITKHNDDEQYAWESSAGGSFTVRTDTGEPM GRGTKVILHLKEDQTEYLEERRIKEIVKKHSQFIGYPITLFVEKERDKEVSDDEAEEKED KEEEKEKEEKESEDKPEIEDVGSDEEEEKKDGDKKKKKKIKEKYIDQEELNKTKPIWTRN PDDITNEEYGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFVPRRAPFDLFENRKKKNN IKLYVRRVFIMDNCEELIPEYLNFIRGVVDSEDLPLNISREMLQQSKILKVIRKNLVKKC LELFTELAEDKENYKKFYEQFSKNIKLGIHEDSQNRKKLSELLRYYTSASGDEMVSLKDY CTRMKENQKHIYYITGETKDQVANSAFVERLRKHGLEVIYMIEPIDEYCVQQLKEFEGKT LVSVTKEGLELPEDEEEKKKQEEKKTKFENLCKIMKDILEKKVEKVVVSNRLVTSPCCIV TSTYGWTANMERIMKAQALRDNSTMGYMAAKKHLEINPDHSIIETLRQKAEADKNDKSVK DLVILLYETALLSSGFSLEDPQTHANRIYRMIKLGLGIDEDDPTADDTSAAVTEEMPPLE GDDDTSRMEEVD |
||
| Pathway Map | MAP LINK | ||
| KEGG ID | hsa3320 | ||
| TTD ID | T18477 | ||
| Pfam | PF00183; PF02518; PF10158; PF13589 | ||
| Pair Name | Curcumin, Temozolomide | |||
| Phytochemical Name | Curcumin | |||
| Anticancer drug Name | Temozolomide | |||
| Disease Info | [ICD-11: 2A00] | Glioblastoma multiforme | Investigative | |
| Regulate Info | Down-regulation | Heat shock protein HSP 90-alpha | Expression | |
| Result | We showed for the first time that exosomes released from drug-treated U87 cells could be a new therapeutic approach in glioblastoma, and could reduce the side effects produced by drugs alone. This concept needs to be further examined in animal models before clinical trials could be considered. | |||
| Pair Name | Lentinan, Oxaliplatin | |||
| Phytochemical | Lentinan | |||
| Drug | Oxaliplatin | |||
| Disease Info | [ICD-11: 2B70] | Esophageal cancer | Investigative | |
| Regulate Info | Up-regulation | Heat shock protein HSP 90-alpha | Expression | |
| Result | These data imply that LNT increases the susceptibility of esophageal cancerous cells to Oxa by driving EC-109 cells to display immunogenic death. Therefore, LNT combined with Oxa may be an effective method in esophageal cancer management. | |||
| Pair Name | Zeylenone, Cisplatin | |||
| Phytochemical | Zeylenone | |||
| Drug | Cisplatin | |||
| Disease Info | [ICD-11: 2B51] | Osteosarcoma | Investigative | |
| Regulate Info | Down-regulation | Heat shock protein HSP 90-alpha | Expression | |
| Result | Zeylenone synergizes with cisplatin in osteosarcoma by enhancing DNA damage, apoptosis, and necrosis via the Hsp90/AKT/GSK3β and Fanconi anaemia pathway | |||
| No. | Title | Href |
|---|---|---|
| 1 | Exosomes released from U87 glioma cells treated with curcumin and/or temozolomide produce apoptosis in naive U87 cells. Pathol Res Pract. 2023 May;245:154427. doi: 10.1016/j.prp.2023.154427. | Click |
| 2 | Lentinan Enhances the Function of Oxaliplatin on the Esophageal Tumors by Persuading Immunogenic Cell Death. Comput Math Methods Med. 2023 Oct 4;2023:9827631. doi: 10.1155/2023/9827631. | Click |
| 3 | Zeylenone synergizes with cisplatin in osteosarcoma by enhancing DNA damage, apoptosis, and necrosis via the Hsp90/AKT/GSK3β and Fanconi anaemia pathway. Phytother Res. 2021 Oct;35(10):5899-5918. doi: 10.1002/ptr.7299 | Click |
