TOP
Nav Bar
  1. General Info
  2. Effects Info
  3. Reference
Molecular Details
01. General Information
Name GA-binding protein alpha chain
UniProt ID GABPA_HUMAN
Gene Name GABPA
Gene ID 2551
Synonyms
GABPA, E4TF1-60, E4TF1A, NFT2, NRF2, NRF2A, RCH04A07
Sequence
MTKREAEELIEIEIDGTEKAECTEESIVEQTYAPAECVSQAIDINEPIGNLKKLLEPRLQ
CSLDAHEICLQDIQLDPERSLFDQGVKTDGTVQLSVQVISYQGIEPKLNILEIVKPADTV
EVVIDPDAHHAESEAHLVEEAQVITLDGTKHITTISDETSEQVTRWAAALEGYRKEQERL
GIPYDPIQWSTDQVLHWVVWVMKEFSMTDIDLTTLNISGRELCSLNQEDFFQRVPRGEIL
WSHLELLRKYVLASQEQQMNEIVTIDQPVQIIPASVQSATPTTIKVINSSAKAAKVQRAP
RISGEDRSSPGNRTGNNGQIQLWQFLLELLTDKDARDCISWVGDEGEFKLNQPELVAQKW
GQRKNKPTMNYEKLSRALRYYYDGDMICKVQGKRFVYKFVCDLKTLIGYSAAELNRLVTE
CEQKKLAKMQLHGIAQPVTAVALATASLQTEKDN
Pathway Map MAP LINK
KEGG ID hsa2551
Pfam PF00178; PF00240; PF02198; PF11620
02. Combinatorial Therapeutic Effect(s)
Synergistic Effect
Hide/Show
Decreasing Drug Toxicity
Hide/Show
Combination Pair ID: 344
Pair Name Daphnetin, Cisplatin
Phytochemical Name Daphnetin
Anticancer drug Name Cisplatin
Disease Info Nephrotoxicity
Regulate Info Up-regulation GA-binding protein alpha chain Expression
Result The results of this study suggested that daphnetin inhibited cisplatin-induced nephrotoxicity by inhibiting NF-κB and activating Nrf2 signaling pathways. Daphnetin might be a promising agent in the treatment of kidney injury.
Enhancing Drug Efficacy
Hide/Show
Combination Pair ID: 648
Pair Name Kuromanin chloride, Cisplatin
Phytochemical Kuromanin chloride
Drug Cisplatin
Disease Info [ICD-11: 2C77.Z] Cervical cancer Investigative
Regulate Info Down-regulation GA-binding protein alpha chain Expression
Result These results expanded our understanding of the role of C3G in a cervical cancer cell model, and provided a potential new treatment strategy for this cancer, as well as a theoretical basis for the development of new drugs in the future.
Combination Pair ID: 731
Pair Name Cryptotanshinone, Gefitinib
Phytochemical Cryptotanshinone
Drug Gefitinib
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Down-regulation GA-binding protein alpha chain Expression
Result These findings indicated the role of TKT in lung cancer progression and may provide novel therapeutic strategies to overcome resistance to gefitinib. Furthermore, CTS may serve as a new candidate in adjuvant treatment of advanced lung cancer.
Combination Pair ID: 854
Pair Name Kaempferol, Docetaxel
Phytochemical Kaempferol
Drug Docetaxel
Disease Info [ICD-11: 2C82.0] Prostate cancer Investigative
Regulate Info Up-regulation GA-binding protein alpha chain Expression
Result The above cellular and animal data suggest that docetaxel in combination with kaempferol has significant anti-prostate cancer effects and that it works by inducing autophagy in cells.
Reversing Drug Resistance
Hide/Show
Combination Pair ID: 853
Pair Name Luteolin, Oxaliplatin
Phytochemical Luteolin
Drug Oxaliplatin
Disease Info [ICD-11: 2B90.Z] Colon cancer Investigative
Regulate Info Down-regulation GA-binding protein alpha chain Expression
Result Adaptive activation of Nrf2 may contribute to the development of acquired drug-resistance and luteolin could restore sensitivity of oxaliplatin-resistant cell lines to chemotherapeutic drugs. Inhibition of the Nrf2 pathway may be the mechanism for this restored therapeutic response.
03. Reference
No. Title Href
1 Daphnetin protects against cisplatin-induced nephrotoxicity by inhibiting inflammatory and oxidative response. Int Immunopharmacol. 2018 Dec;65:402-407. doi: 10.1016/j.intimp.2018.10.018. Click
2 Combination of cyanidin-3-O-glucoside and cisplatin induces oxidative stress and apoptosis in HeLa cells by reducing activity of endogenous antioxidants, increasing bax/bcl-2 mRNA expression ratio, and downregulating Nrf2 expression. J Food Biochem. 2021 Jul;45(7):e13806. doi: 10.1111/jfbc.13806. Click
3 Cryptotanshinone strengthens the effect of gefitinib against non-small cell lung cancer through inhibiting transketolase. Eur J Pharmacol. 2021 Jan 5;890:173647. doi: 10.1016/j.ejphar.2020.173647. Click
4 Combination of Kaempferol and Docetaxel Induces Autophagy in Prostate Cancer Cells In Vitro and In Vivo. Int J Mol Sci. 2023 Sep 25;24(19):14519. doi: 10.3390/ijms241914519. Click
5 Luteolin sensitizes two oxaliplatin-resistant colorectal cancer cell lines to chemotherapeutic drugs via inhibition of the Nrf2 pathway. Asian Pac J Cancer Prev. 2014;15(6):2911-6. doi: 10.7314/apjcp.2014.15.6.2911. Click
It has been None visits since 2024.08
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang
TOP