InterPAD - DETAILS

MTKREAEELIEIEIDGTEKAECTEESIVEQTYAPAECVSQAIDINEPIGNLKKLLEPRLQ
CSLDAHEICLQDIQLDPERSLFDQGVKTDGTVQLSVQVISYQGIEPKLNILEIVKPADTV
EVVIDPDAHHAESEAHLVEEAQVITLDGTKHITTISDETSEQVTRWAAALEGYRKEQERL
GIPYDPIQWSTDQVLHWVVWVMKEFSMTDIDLTTLNISGRELCSLNQEDFFQRVPRGEIL
WSHLELLRKYVLASQEQQMNEIVTIDQPVQIIPASVQSATPTTIKVINSSAKAAKVQRAP
RISGEDRSSPGNRTGNNGQIQLWQFLLELLTDKDARDCISWVGDEGEFKLNQPELVAQKW
GQRKNKPTMNYEKLSRALRYYYDGDMICKVQGKRFVYKFVCDLKTLIGYSAAELNRLVTE
CEQKKLAKMQLHGIAQPVTAVALATASLQTEKDN

No.	Title	Href
1	Daphnetin protects against cisplatin-induced nephrotoxicity by inhibiting inflammatory and oxidative response. Int Immunopharmacol. 2018 Dec;65:402-407. doi: 10.1016/j.intimp.2018.10.018.	`Click`
2	Cryptotanshinone strengthens the effect of gefitinib against non-small cell lung cancer through inhibiting transketolase. Eur J Pharmacol. 2021 Jan 5;890:173647. doi: 10.1016/j.ejphar.2020.173647.	`Click`
3	Combination of Kaempferol and Docetaxel Induces Autophagy in Prostate Cancer Cells In Vitro and In Vivo. Int J Mol Sci. 2023 Sep 25;24(19):14519. doi: 10.3390/ijms241914519.	`Click`
4	Combination of cyanidin-3-O-glucoside and cisplatin induces oxidative stress and apoptosis in HeLa cells by reducing activity of endogenous antioxidants, increasing bax/bcl-2 mRNA expression ratio, and downregulating Nrf2 expression. J Food Biochem. 2021 Jul;45(7):e13806. doi: 10.1111/jfbc.13806.	`Click`
5	Luteolin sensitizes two oxaliplatin-resistant colorectal cancer cell lines to chemotherapeutic drugs via inhibition of the Nrf2 pathway. Asian Pac J Cancer Prev. 2014;15(6):2911-6. doi: 10.7314/apjcp.2014.15.6.2911.	`Click`

No.

Title

Href

Daphnetin protects against cisplatin-induced nephrotoxicity by inhibiting inflammatory and oxidative response. Int Immunopharmacol. 2018 Dec;65:402-407. doi: 10.1016/j.intimp.2018.10.018.

Click

Cryptotanshinone strengthens the effect of gefitinib against non-small cell lung cancer through inhibiting transketolase. Eur J Pharmacol. 2021 Jan 5;890:173647. doi: 10.1016/j.ejphar.2020.173647.

Click

Combination of Kaempferol and Docetaxel Induces Autophagy in Prostate Cancer Cells In Vitro and In Vivo. Int J Mol Sci. 2023 Sep 25;24(19):14519. doi: 10.3390/ijms241914519.

Click

Combination of cyanidin-3-O-glucoside and cisplatin induces oxidative stress and apoptosis in HeLa cells by reducing activity of endogenous antioxidants, increasing bax/bcl-2 mRNA expression ratio, and downregulating Nrf2 expression. J Food Biochem. 2021 Jul;45(7):e13806. doi: 10.1111/jfbc.13806.

Click

Luteolin sensitizes two oxaliplatin-resistant colorectal cancer cell lines to chemotherapeutic drugs via inhibition of the Nrf2 pathway. Asian Pac J Cancer Prev. 2014;15(6):2911-6. doi: 10.7314/apjcp.2014.15.6.2911.

Click

Name	GA-binding protein alpha chain
UniProt ID	GABPA_HUMAN
Gene Name	GABPA
Gene ID	2551
Synonyms	GABPA, E4TF1-60, E4TF1A, NFT2, NRF2, NRF2A, RCH04A07
Sequence	MTKREAEELIEIEIDGTEKAECTEESIVEQTYAPAECVSQAIDINEPIGNLKKLLEPRLQ CSLDAHEICLQDIQLDPERSLFDQGVKTDGTVQLSVQVISYQGIEPKLNILEIVKPADTV EVVIDPDAHHAESEAHLVEEAQVITLDGTKHITTISDETSEQVTRWAAALEGYRKEQERL GIPYDPIQWSTDQVLHWVVWVMKEFSMTDIDLTTLNISGRELCSLNQEDFFQRVPRGEIL WSHLELLRKYVLASQEQQMNEIVTIDQPVQIIPASVQSATPTTIKVINSSAKAAKVQRAP RISGEDRSSPGNRTGNNGQIQLWQFLLELLTDKDARDCISWVGDEGEFKLNQPELVAQKW GQRKNKPTMNYEKLSRALRYYYDGDMICKVQGKRFVYKFVCDLKTLIGYSAAELNRLVTE CEQKKLAKMQLHGIAQPVTAVALATASLQTEKDN
Pathway Map	`MAP LINK`
KEGG ID	hsa2551
Pfam	PF00178; PF00240; PF02198; PF11620

Pair Name	Daphnetin, Cisplatin
Phytochemical Name	Daphnetin
Anticancer drug Name	Cisplatin
Disease Info	Nephrotoxicity
Regulate Info	Up-regulation	GA-binding protein alpha chain	Expression
Result	The results of this study suggested that daphnetin inhibited cisplatin-induced nephrotoxicity by inhibiting NF-κB and activating Nrf2 signaling pathways. Daphnetin might be a promising agent in the treatment of kidney injury.

Pair Name	Cryptotanshinone, Gefitinib
Phytochemical	Cryptotanshinone
Drug	Gefitinib
Disease Info	[ICD-11: 2C25]	Lung cancer	Investigative
Regulate Info	Down-regulation	GA-binding protein alpha chain	Expression
Result	These findings indicated the role of TKT in lung cancer progression and may provide novel therapeutic strategies to overcome resistance to gefitinib. Furthermore, CTS may serve as a new candidate in adjuvant treatment of advanced lung cancer.

Pair Name	Kaempferol, Docetaxel
Phytochemical	Kaempferol
Drug	Docetaxel
Disease Info	[ICD-11: 2C82]	Prostate cancer	Investigative
Regulate Info	Up-regulation	GA-binding protein alpha chain	Expression
Result	The above cellular and animal data suggest that docetaxel in combination with kaempferol has significant anti-prostate cancer effects and that it works by inducing autophagy in cells.

Pair Name	Kuromanin chloride, Cisplatin
Phytochemical	Kuromanin chloride
Drug	Cisplatin
Disease Info	[ICD-11: 2C77]	Cervical cancer	Investigative
Regulate Info	Down-regulation	GA-binding protein alpha chain	Expression
Result	These results expanded our understanding of the role of C3G in a cervical cancer cell model, and provided a potential new treatment strategy for this cancer, as well as a theoretical basis for the development of new drugs in the future.

Pair Name	Luteolin, Oxaliplatin
Phytochemical	Luteolin
Drug	Oxaliplatin
Disease Info	[ICD-11: 2B90]	Colon cancer	Investigative
Regulate Info	Down-regulation	GA-binding protein alpha chain	Expression
Result	Adaptive activation of Nrf2 may contribute to the development of acquired drug-resistance and luteolin could restore sensitivity of oxaliplatin-resistant cell lines to chemotherapeutic drugs. Inhibition of the Nrf2 pathway may be the mechanism for this restored therapeutic response.