| Name | Eukaryotic translation initiation factor 4E-binding protein 1 | ||
| UniProt ID | 4EBP1_HUMAN | ||
| Gene Name | EIF4EBP1 | ||
| Gene ID | 1978 | ||
| Synonyms |
EIF4EBP1, 4E-BP1, 4EBP1, BP-1, PHAS-I
|
||
| Sequence |
MSGGSSCSQTPSRAIPATRRVVLGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLM
ECRNSPVTKTPPRDLPTIPGVTSPSSDEPPMEASQSHLRNSPEDKRAGGEESQFEMDI |
||
| Pathway Map | MAP LINK | ||
| KEGG ID | hsa1978 | ||
| TTD ID | T84941 | ||
| Pfam | PF05456 | ||
| Pair Name | Fangchinoline, Everolimus | |||
| Phytochemical | Fangchinoline | |||
| Drug | Everolimus | |||
| Disease Info | [ICD-11: 2C25.Z] | Lung cancer | Investigative | |
| Regulate Info | Down-regulation | Eukaryotic translation initiation factor 4E-binding protein 1 | Phosphorylation | |
| Result | Firstly link CHOP to Notch 3/c-MYC axis-dependent apoptosis and provide the Notch 3/c-MYC/CHOP activation as a promising strategy for mTOR-targeted combination therapy in lung cancer treatment. | |||
| Pair Name | Fisetin, Fluorouracil | |||
| Phytochemical | Fisetin | |||
| Drug | Fluorouracil | |||
| Disease Info | [ICD-11: 2B91.Z] | Colorectal cancer | Investigative | |
| Regulate Info | Down-regulation | Eukaryotic translation initiation factor 4E-binding protein 1 | Phosphorylation | |
| Result | Fisetin and 5-fluorouracil: Effective combination for PIK3CA-mutant colorectal cancer | |||
| Pair Name | Brusatol, Cabergoline | |||
| Phytochemical | Brusatol | |||
| Drug | Cabergoline | |||
| Disease Info | [ICD-11: 2F37] | Pituitary adenomas | Investigative | |
| Regulate Info | Down-regulation | Eukaryotic translation initiation factor 4E-binding protein 1 | Phosphorylation | |
| Result | Combined use of CAB and BT may increase the clinical effectiveness of treatment for human pituitary adenomas. | |||
| No. | Title | Href |
|---|---|---|
| 1 | Activation of notch 3/c-MYC/CHOP axis regulates apoptosis and promotes sensitivity of lung cancer cells to mTOR inhibitor everolimus. Biochem Pharmacol. 2020 May;175:113921. doi: 10.1016/j.bcp.2020.113921. | Click |
| 2 | Fisetin and 5-fluorouracil: Effective combination for PIK3CA-mutant colorectal cancer. Int J Cancer. 2019 Dec 1;145(11):3022-3032. doi: 10.1002/ijc.32367. | Click |
| 3 | Brusatol Inhibits Tumor Growth and Increases the Efficacy of Cabergoline against Pituitary Adenomas. Oxid Med Cell Longev. 2021 Jun 16;2021:6696015. doi: 10.1155/2021/6696015. | Click |
