TOP
Nav Bar
  1. General Info
  2. Effects Info
  3. Reference
Molecular Details
01. General Information
Name Ubiquitin-like modifier-activating enzyme ATG7
UniProt ID ATG7_HUMAN
Gene Name ATG7
Gene ID 10533
Synonyms
ATG7, APG7-LIKE, APG7L, GSA7, SCAR31
Sequence
MAAATGDPGLSKLQFAPFSSALDVGFWHELTQKKLNEYRLDEAPKDIKGYYYNGDSAGLP
ARLTLEFSAFDMSAPTPARCCPAIGTLYNTNTLESFKTADKKLLLEQAANEIWESIKSGT
ALENPVLLNKFLLLTFADLKKYHFYYWFCYPALCLPESLPLIQGPVGLDQRFSLKQIEAL
ECAYDNLCQTEGVTALPYFLIKYDENMVLVSLLKHYSDFFQGQRTKITIGVYDPCNLAQY
PGWPLRNFLVLAAHRWSSSFQSVEVVCFRDRTMQGARDVAHSIIFEVKLPEMAFSPDCPK
AVGWEKNQKGGMGPRMVNLSECMDPKRLAESSVDLNLKLMCWRLVPTLDLDKVVSVKCLL
LGAGTLGCNVARTLMGWGVRHITFVDNAKISYSNPVRQPLYEFEDCLGGGKPKALAAADR
LQKIFPGVNARGFNMSIPMPGHPVNFSSVTLEQARRDVEQLEQLIESHDVVFLLMDTRES
RWLPAVIAASKRKLVINAALGFDTFVVMRHGLKKPKQQGAGDLCPNHPVASADLLGSSLF
ANIPGYKLGCYFCNDVVAPGDSTRDRTLDQQCTVSRPGLAVIAGALAVELMVSVLQHPEG
GYAIASSSDDRMNEPPTSLGLVPHQIRGFLSRFDNVLPVSLAFDKCTACSSKVLDQYERE
GFNFLAKVFNSSHSFLEDLTGLTLLHQETQAAEIWDMSDDETI
Pathway Map MAP LINK
T.C. Number 9.A.15.2.1
KEGG ID hsa10533
TTD ID T20302
Pfam PF00899; PF01488; PF16420
02. Combinatorial Therapeutic Effect(s)
Synergistic Effect
Hide/Show
Decreasing Drug Toxicity
Hide/Show
Combination Pair ID: 989
Pair Name Baicalein, Epirubicin
Phytochemical Name Baicalein
Anticancer drug Name Epirubicin
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Up-regulation Ubiquitin-like modifier-activating enzyme ATG7 Expression
Result BTME (200μg/mL) significantly enhanced epirubicin's cytotoxicity against Hep-G2 cells and ameliorated its safety profile. BTME could exert anti-hepatocarcinoma effect by enhancing apoptosis and autophagy
Enhancing Drug Efficacy
Hide/Show
Combination Pair ID: 118
Pair Name Ginsenoside Ro, Fluorouracil
Phytochemical Ginsenoside Ro
Drug Fluorouracil
Disease Info [ICD-11: 2B70] Esophageal cancer Investigative
Regulate Info Up-regulation Ubiquitin-like modifier-activating enzyme ATG7 Expression
Result Ginsenoside Ro suppresses autophagy by interfering with autophagosome-lysosome fusion and lysosomal proteolytic activity via the ESR2-NCF1-ROS axis. Subsequently, such autophagic inhibition reduces CHEK1 degradation, enhances CHEK1-mediated DNA damage checkpoint arrest, and thereby sensitizes tumor cells to 5-Fu-induced cell death.
Combination Pair ID: 119
Pair Name Morin Hydrate, Cisplatin
Phytochemical Morin Hydrate
Drug Cisplatin
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Down-regulation Ubiquitin-like modifier-activating enzyme ATG7 Expression
Result Our findings indicate that CP-Mh in combination served as a prominent regulator of autophagy and significant inducer of apoptosis that maintains a homeostatic balance towards HepG2 cells and the subcutaneous tumor model.
Combination Pair ID: 190
Pair Name Ursolic acid, Epirubicin
Phytochemical Ursolic acid
Drug Epirubicin
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Ubiquitin-like modifier-activating enzyme ATG7 Expression
Result These findings indicate that UA can dramatically enhance the sensitivity of MCF-7 and MDA-MB-231 cells to EPI by modulating the autophagy pathway. Our study may provide a new therapeutic strategy for combination therapy.
Combination Pair ID: 374
Pair Name Resveratrol, Talazoparib
Phytochemical Resveratrol
Drug Talazoparib
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Ubiquitin-like modifier-activating enzyme ATG7 Expression
Result Resveratrol sensitizes breast cancer to PARP inhibitor, talazoparib through dual inhibition of AKT and autophagy flux
Combination Pair ID: 869
Pair Name Shogaol, Fluorouracil
Phytochemical Shogaol
Drug Fluorouracil
Disease Info [ICD-11: 2B90.Z] Colon cancer Investigative
Regulate Info Up-regulation Ubiquitin-like modifier-activating enzyme ATG7 Expression
Result Our data suggest that the addition of 6-shogaol to established chemotherapeutic regimens could potentially be a remarkable therapeutic strategy for colorectal cancer.
03. Reference
No. Title Href
1 Chemotherapeutic effect of baicalein/epirubicin combination against liver cell carcinoma in-vitro: Inducing apoptosis and autophagy. Toxicol In Vitro. 2024 Mar;95:105744. doi: 10.1016/j.tiv.2023.105744. Click
2 Inhibition of autophagosome-lysosome fusion by ginsenoside Ro via the ESR2-NCF1-ROS pathway sensitizes esophageal cancer cells to 5-fluorouracil-induced cell death via the CHEK1-mediated DNA damage checkpoint. Autophagy. 2016;12(9):1593-1613. doi:10.1080/15548627.2016.1192751 Click
3 Morin Hydrate Sensitizes Hepatoma Cells and Xenograft Tumor towards Cisplatin by Downregulating PARP-1-HMGB1 Mediated Autophagy. Int J Mol Sci. 2020 Nov 4;21(21):8253. doi: 10.3390/ijms21218253. Click
4 Ursolic Acid Enhances the Sensitivity of MCF-7 and MDA-MB-231 Cells to Epirubicin by Modulating the Autophagy Pathway. Molecules. 2022 May 25;27(11):3399. doi: 10.3390/molecules27113399. Click
5 Resveratrol sensitizes breast cancer to PARP inhibitor, talazoparib through dual inhibition of AKT and autophagy flux. Biochem Pharmacol. 2022 May;199:115024. doi: 10.1016/j.bcp.2022.115024. Click
6 6-Shogaol enhances the anticancer effect of 5-fluorouracil, oxaliplatin, and irinotecan via increase of apoptosis and autophagy in colon cancer cells in hypoxic/aglycemic conditions. BMC Complement Med Ther. 2020 May 11;20(1):141. doi: 10.1186/s12906-020-02913-8. Click
It has been 595889 visits since 2024.08
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang
TOP