Name | Proto-oncogene Wnt-1 | ||
UniProt ID | WNT1_HUMAN | ||
Gene Name | WNT1 | ||
Gene ID | 7471 | ||
Synonyms |
WNT1, BMND16, INT1, OI15
|
||
Sequence |
MGLWALLPGWVSATLLLALAALPAALAANSSGRWWGIVNVASSTNLLTDSKSLQLVLEPS
LQLLSRKQRRLIRQNPGILHSVSGGLQSAVRECKWQFRNRRWNCPTAPGPHLFGKIVNRG CRETAFIFAITSAGVTHSVARSCSEGSIESCTCDYRRRGPGGPDWHWGGCSDNIDFGRLF GREFVDSGEKGRDLRFLMNLHNNEAGRTTVFSEMRQECKCHGMSGSCTVRTCWMRLPTLR AVGDVLRDRFDGASRVLYGNRGSNRASRAELLRLEPEDPAHKPPSPHDLVYFEKSPNFCT YSGRLGTAGTAGRACNSSSPALDGCELLCCGRGHRTRTQRVTERCNCTFHWCCHVSCRNC THTRVLHECL |
||
Pathway Map | MAP LINK | ||
KEGG ID | hsa7471 | ||
Pfam | PF00110 |
Pair Name | Sulforaphane, Metformin | |||
Phytochemical | Sulforaphane | |||
Drug | Metformin | |||
Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
Regulate Info | Down-regulation | Proto-oncogene Wnt-1 | Expression | |
Result | Our data indicate that SLFN and MTFN can reduce cancer cell viability via both collaborative and differential effects and suggest that MTFN increases SLFN effectiveness by targeting common molecules/pathways downstream of HER2 and key for CSC signaling. |
Pair Name | Thymoquinone, Fluorouracil | |||
Phytochemical | Thymoquinone | |||
Drug | Fluorouracil | |||
Disease Info | [ICD-11: 2A00-2F9Z] | Solid tumour or cancer | Investigative | |
Regulate Info | Down-regulation | Proto-oncogene Wnt-1 | Expression | |
Result | Our findings present the first report describing the in vivo enhancement effect of combined TQ and 5-FU against early stages of CRC; however, further studies are required to determine the value of this combination therapy in an advanced long-term model of CRC and also to realize its clinical potential. |
No. | Title | Href |
---|---|---|
1 | Co-Treatment with Sulforaphane and Nano-Metformin Molecules Accelerates Apoptosis in HER2+ Breast Cancer Cells by Inhibiting Key Molecules. Nutr Cancer. 2020;72(5):835-848. doi: 10.1080/01635581.2019.1655073. | Click |
2 | Thymoquinone subdues tumor growth and potentiates the chemopreventive effect of 5-fluorouracil on the early stages of colorectal carcinogenesis in rats. Drug Des Devel Ther. 2016 Jul 11;10:2239-53. doi: 10.2147/DDDT.S109721. | Click |