| Name | Thymidine kinase | ||
| UniProt ID | KITH_HUMAN | ||
| Gene Name | TK1 | ||
| Gene ID | 7083 | ||
| Synonyms |
TK1, TK2
|
||
| Sequence |
MSCINLPTVLPGSPSKTRGQIQVILGPMFSGKSTELMRRVRRFQIAQYKCLVIKYAKDTR
YSSSFCTHDRNTMEALPACLLRDVAQEALGVAVIGIDEGQFFPDIVEFCEAMANAGKTVI VAALDGTFQRKPFGAILNLVPLAESVVKLTAVCMECFREAAYTKRLGTEKEVEVIGGADK YHSVCRLCYFKKASGQPAGPDNKENCPVPGKPGEAVAARKLFAPQQILQCSPAN |
||
| Pathway Map | MAP LINK | ||
| T.C. Number | 2.A.56.3.4; 2.A.60.1.4; 8.A.23.1.35 | ||
| KEGG ID | hsa7083 | ||
| TTD ID | T30081 | ||
| Pfam | PF00265; PF01637; PF13173 | ||
| Pair Name | Baicalin, Fluorouracil | |||
| Phytochemical | Baicalin | |||
| Drug | Fluorouracil | |||
| Disease Info | [ICD-11: 2B91] | Colorectal cancer | Investigative | |
| Regulate Info | Down-regulation | Thymidine kinase | Expression | |
| Result | These results indicate that HQ and its component baicalin enhance the effect of 5-fluorouracil-based chemotherapy via inhibition of CDK-RB pathway. These findings may provide the rational basis for developing agents that can overcome the development of cellular drug resistance. Video Abstract. | |||
| Pair Name | Cryptotanshinone, Gefitinib | |||
| Phytochemical | Cryptotanshinone | |||
| Drug | Gefitinib | |||
| Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
| Regulate Info | Down-regulation | Thymidine kinase | Expression | |
| Result | These findings indicated the role of TKT in lung cancer progression and may provide novel therapeutic strategies to overcome resistance to gefitinib. Furthermore, CTS may serve as a new candidate in adjuvant treatment of advanced lung cancer. | |||
| No. | Title | Href |
|---|---|---|
| 1 | Scutellaria baicalensis enhances 5-fluorouracil-based chemotherapy via inhibition of proliferative signaling pathways. Cell Commun Signal. 2023 Jun 19;21(1):147. doi: 10.1186/s12964-023-01156-7. | Click |
| 2 | Cryptotanshinone strengthens the effect of gefitinib against non-small cell lung cancer through inhibiting transketolase. Eur J Pharmacol. 2021 Jan 5;890:173647. doi: 10.1016/j.ejphar.2020.173647. | Click |
