TOP
Nav Bar
  1. General Info
  2. Effects Info
  3. Reference
Molecular Details
01. General Information
Name Thymidine kinase
UniProt ID KITH_HUMAN
Gene Name TK1
Gene ID 7083
Synonyms
TK1, TK2
Sequence
MSCINLPTVLPGSPSKTRGQIQVILGPMFSGKSTELMRRVRRFQIAQYKCLVIKYAKDTR
YSSSFCTHDRNTMEALPACLLRDVAQEALGVAVIGIDEGQFFPDIVEFCEAMANAGKTVI
VAALDGTFQRKPFGAILNLVPLAESVVKLTAVCMECFREAAYTKRLGTEKEVEVIGGADK
YHSVCRLCYFKKASGQPAGPDNKENCPVPGKPGEAVAARKLFAPQQILQCSPAN
Pathway Map MAP LINK
T.C. Number 2.A.56.3.4; 2.A.60.1.4; 8.A.23.1.35
KEGG ID hsa7083
TTD ID T30081
Pfam PF00265; PF01637; PF13173
02. Combinatorial Therapeutic Effect(s)
Synergistic Effect
Hide/Show
Enhancing Drug Efficacy
Hide/Show
Combination Pair ID: 72
Pair Name Baicalin, Fluorouracil
Phytochemical Baicalin
Drug Fluorouracil
Disease Info [ICD-11: 2B91.Z] Colorectal cancer Investigative
Regulate Info Down-regulation Thymidine kinase Expression
Result These results indicate that HQ and its component baicalin enhance the effect of 5-fluorouracil-based chemotherapy via inhibition of CDK-RB pathway. These findings may provide the rational basis for developing agents that can overcome the development of cellular drug resistance. Video Abstract.
Combination Pair ID: 731
Pair Name Cryptotanshinone, Gefitinib
Phytochemical Cryptotanshinone
Drug Gefitinib
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Down-regulation Thymidine kinase Expression
Result These findings indicated the role of TKT in lung cancer progression and may provide novel therapeutic strategies to overcome resistance to gefitinib. Furthermore, CTS may serve as a new candidate in adjuvant treatment of advanced lung cancer.
03. Reference
No. Title Href
1 Scutellaria baicalensis enhances 5-fluorouracil-based chemotherapy via inhibition of proliferative signaling pathways. Cell Commun Signal. 2023 Jun 19;21(1):147. doi: 10.1186/s12964-023-01156-7. Click
2 Cryptotanshinone strengthens the effect of gefitinib against non-small cell lung cancer through inhibiting transketolase. Eur J Pharmacol. 2021 Jan 5;890:173647. doi: 10.1016/j.ejphar.2020.173647. Click
It has been 377167 visits since 2024.08
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang
TOP