| Name | Mothers against decapentaplegic homolog 4 | ||
| UniProt ID | SMAD4_HUMAN | ||
| Gene Name | SMAD4 | ||
| Gene ID | 4089 | ||
| Synonyms |
SMAD4, DPC4, JIP, MADH4, MYHRS
|
||
| Sequence |
MDNMSITNTPTSNDACLSIVHSLMCHRQGGESETFAKRAIESLVKKLKEKKDELDSLITA
ITTNGAHPSKCVTIQRTLDGRLQVAGRKGFPHVIYARLWRWPDLHKNELKHVKYCQYAFD LKCDSVCVNPYHYERVVSPGIDLSGLTLQSNAPSSMMVKDEYVHDFEGQPSLSTEGHSIQ TIQHPPSNRASTETYSTPALLAPSESNATSTANFPNIPVASTSQPASILGGSHSEGLLQI ASGPQPGQQQNGFTGQPATYHHNSTTTWTGSRTAPYTPNLPHHQNGHLQHHPPMPPHPGH YWPVHNELAFQPPISNHPAPEYWCSIAYFEMDVQVGETFKVPSSCPIVTVDGYVDPSGGD RFCLGQLSNVHRTEAIERARLHIGKGVQLECKGEGDVWVRCLSDHAVFVQSYYLDREAGR APGDAVHKIYPSAYIKVFDLRQCHRQMQQQAATAQAAAAAQAAAVAGNIPGPGSVGGIAP AISLSAAAGIGVDDLRRLCILRMSFVKGWGPDYPRQSIKETPCWIEIHLHRALQLLDEVL HTMPIADPQPLD |
||
| Pathway Map | MAP LINK | ||
| KEGG ID | hsa4089 | ||
| Pfam | PF03165; PF03166; PF10401 | ||
| Pair Name | Harmine, Paclitaxel | |||
| Phytochemical | Harmine | |||
| Drug | Paclitaxel | |||
| Disease Info | [ICD-11: 2B72.Z] | Gastric cancer | Investigative | |
| Regulate Info | Up-regulation | Mothers against decapentaplegic homolog 4 | Expression | |
| Result | Harmine combined with paclitaxel inhibits tumor proliferation and induces apoptosis through down-regulation of cyclooxygenase-2 expression in gastric cancer | |||
| Pair Name | Piperlongumine, Doxorubicin | |||
| Phytochemical | Piperlongumine | |||
| Drug | Doxorubicin | |||
| Disease Info | [ICD-11: 2B51] | Osteosarcoma | Investigative | |
| Regulate Info | Up-regulation | Mothers against decapentaplegic homolog 4 | Expression | |
| Result | Piperlongumine induces ROS mediated apoptosis by transcriptional regulation of SMAD4/P21/P53 genes and synergizes with doxorubicin in osteosarcoma cells | |||
| Pair Name | Piperlongumine, Paclitaxel | |||
| Phytochemical | Piperlongumine | |||
| Drug | Paclitaxel | |||
| Disease Info | [ICD-11: 2B90.Z] | Colon cancer | Investigative | |
| Regulate Info | Up-regulation | Mothers against decapentaplegic homolog 4 | Expression | |
| Result | Piperlongumine induces ROS mediated cell death and synergizes paclitaxel in human intestinal cancer cells | |||
| Pair Name | Thymoquinone, Fluorouracil | |||
| Phytochemical | Thymoquinone | |||
| Drug | Fluorouracil | |||
| Disease Info | [ICD-11: 2A00-2F9Z] | Solid tumour or cancer | Investigative | |
| Regulate Info | Up-regulation | Mothers against decapentaplegic homolog 4 | Expression | |
| Result | Our findings present the first report describing the in vivo enhancement effect of combined TQ and 5-FU against early stages of CRC; however, further studies are required to determine the value of this combination therapy in an advanced long-term model of CRC and also to realize its clinical potential. | |||
| No. | Title | Href |
|---|---|---|
| 1 | Harmine combined with paclitaxel inhibits tumor proliferation and induces apoptosis through down-regulation of cyclooxygenase-2 expression in gastric cancer. Oncol Lett. 2016 Aug;12(2):983-988. doi: 10.3892/ol.2016.4696. | Click |
| 2 | Piperlongumine induces ROS mediated apoptosis by transcriptional regulation of SMAD4/P21/P53 genes and synergizes with doxorubicin in osteosarcoma cells. Chem Biol Interact. 2022 Feb 25;354:109832. doi: 10.1016/j.cbi.2022.109832. | Click |
| 3 | Piperlongumine induces ROS mediated cell death and synergizes paclitaxel in human intestinal cancer cells. Biomed Pharmacother. 2020 Aug;128:110243. doi: 10.1016/j.biopha.2020.110243. | Click |
| 4 | Thymoquinone subdues tumor growth and potentiates the chemopreventive effect of 5-fluorouracil on the early stages of colorectal carcinogenesis in rats. Drug Des Devel Ther. 2016 Jul 11;10:2239-53. doi: 10.2147/DDDT.S109721. | Click |
