Name | Mothers against decapentaplegic homolog 4 | ||
UniProt ID | SMAD4_HUMAN | ||
Gene Name | SMAD4 | ||
Gene ID | 4089 | ||
Synonyms |
SMAD4, DPC4, JIP, MADH4, MYHRS
|
||
Sequence |
MDNMSITNTPTSNDACLSIVHSLMCHRQGGESETFAKRAIESLVKKLKEKKDELDSLITA
ITTNGAHPSKCVTIQRTLDGRLQVAGRKGFPHVIYARLWRWPDLHKNELKHVKYCQYAFD LKCDSVCVNPYHYERVVSPGIDLSGLTLQSNAPSSMMVKDEYVHDFEGQPSLSTEGHSIQ TIQHPPSNRASTETYSTPALLAPSESNATSTANFPNIPVASTSQPASILGGSHSEGLLQI ASGPQPGQQQNGFTGQPATYHHNSTTTWTGSRTAPYTPNLPHHQNGHLQHHPPMPPHPGH YWPVHNELAFQPPISNHPAPEYWCSIAYFEMDVQVGETFKVPSSCPIVTVDGYVDPSGGD RFCLGQLSNVHRTEAIERARLHIGKGVQLECKGEGDVWVRCLSDHAVFVQSYYLDREAGR APGDAVHKIYPSAYIKVFDLRQCHRQMQQQAATAQAAAAAQAAAVAGNIPGPGSVGGIAP AISLSAAAGIGVDDLRRLCILRMSFVKGWGPDYPRQSIKETPCWIEIHLHRALQLLDEVL HTMPIADPQPLD |
||
Pathway Map | MAP LINK | ||
KEGG ID | hsa4089 | ||
Pfam | PF03165; PF03166; PF10401 |
Pair Name | Harmine, Paclitaxel | |||
Phytochemical | Harmine | |||
Drug | Paclitaxel | |||
Disease Info | [ICD-11: 2B72] | Gastric cancer | Investigative | |
Regulate Info | Up-regulation | Mothers against decapentaplegic homolog 4 | Expression | |
Result | Harmine combined with paclitaxel inhibits tumor proliferation and induces apoptosis through down-regulation of cyclooxygenase-2 expression in gastric cancer |
Pair Name | Piperlongumine, Doxorubicin | |||
Phytochemical | Piperlongumine | |||
Drug | Doxorubicin | |||
Disease Info | [ICD-11: 2B51] | Osteosarcoma | Investigative | |
Regulate Info | Up-regulation | Mothers against decapentaplegic homolog 4 | Expression | |
Result | Piperlongumine induces ROS mediated apoptosis by transcriptional regulation of SMAD4/P21/P53 genes and synergizes with doxorubicin in osteosarcoma cells |
Pair Name | Piperlongumine, Paclitaxel | |||
Phytochemical | Piperlongumine | |||
Drug | Paclitaxel | |||
Disease Info | [ICD-11: 2B90] | Colon cancer | Investigative | |
Regulate Info | Up-regulation | Mothers against decapentaplegic homolog 4 | Expression | |
Result | Piperlongumine induces ROS mediated cell death and synergizes paclitaxel in human intestinal cancer cells |
Pair Name | Thymoquinone, Fluorouracil | |||
Phytochemical | Thymoquinone | |||
Drug | Fluorouracil | |||
Disease Info | [ICD-11: 2A00-2F9Z] | Solid tumour or cancer | Investigative | |
Regulate Info | Up-regulation | Mothers against decapentaplegic homolog 4 | Expression | |
Result | Our findings present the first report describing the in vivo enhancement effect of combined TQ and 5-FU against early stages of CRC; however, further studies are required to determine the value of this combination therapy in an advanced long-term model of CRC and also to realize its clinical potential. |
No. | Title | Href |
---|---|---|
1 | Harmine combined with paclitaxel inhibits tumor proliferation and induces apoptosis through down-regulation of cyclooxygenase-2 expression in gastric cancer. Oncol Lett. 2016 Aug;12(2):983-988. doi: 10.3892/ol.2016.4696. | Click |
2 | Piperlongumine induces ROS mediated apoptosis by transcriptional regulation of SMAD4/P21/P53 genes and synergizes with doxorubicin in osteosarcoma cells. Chem Biol Interact. 2022 Feb 25;354:109832. doi: 10.1016/j.cbi.2022.109832. | Click |
3 | Piperlongumine induces ROS mediated cell death and synergizes paclitaxel in human intestinal cancer cells. Biomed Pharmacother. 2020 Aug;128:110243. doi: 10.1016/j.biopha.2020.110243. | Click |
4 | Thymoquinone subdues tumor growth and potentiates the chemopreventive effect of 5-fluorouracil on the early stages of colorectal carcinogenesis in rats. Drug Des Devel Ther. 2016 Jul 11;10:2239-53. doi: 10.2147/DDDT.S109721. | Click |