| Name | Receptor-interacting serine/threonine-protein kinase 1 | ||
| UniProt ID | RIPK1_HUMAN | ||
| Gene Name | RIPK1 | ||
| Gene ID | 8737 | ||
| Synonyms |
RIPK1, AIEFL, IMD57, RIP, RIP-1, RIP1
|
||
| Sequence |
MQPDMSLNVIKMKSSDFLESAELDSGGFGKVSLCFHRTQGLMIMKTVYKGPNCIEHNEAL
LEEAKMMNRLRHSRVVKLLGVIIEEGKYSLVMEYMEKGNLMHVLKAEMSTPLSVKGRIIL EIIEGMCYLHGKGVIHKDLKPENILVDNDFHIKIADLGLASFKMWSKLNNEEHNELREVD GTAKKNGGTLYYMAPEHLNDVNAKPTEKSDVYSFAVVLWAIFANKEPYENAICEQQLIMC IKSGNRPDVDDITEYCPREIISLMKLCWEANPEARPTFPGIEEKFRPFYLSQLEESVEED VKSLKKEYSNENAVVKRMQSLQLDCVAVPSSRSNSATEQPGSLHSSQGLGMGPVEESWFA PSLEHPQEENEPSLQSKLQDEANYHLYGSRMDRQTKQQPRQNVAYNREEERRRRVSHDPF AQQRPYENFQNTEGKGTAYSSAASHGNAVHQPSGLTSQPQVLYQNNGLYSSHGFGTRPLD PGTAGPRVWYRPIPSHMPSLHNIPVPETNYLGNTPTMPFSSLPPTDESIKYTIYNSTGIQ IGAYNYMEIGGTSSSLLDSTNTNFKEEPAAKYQAIFDNTTSLTDKHLDPIRENLGKHWKN CARKLGFTQSQIDEIDHDYERDGLKEKVYQMLQKWVMREGIKGATVGKLAQALHQCSRID LLSSLIYVSQN |
||
| Pathway Map | MAP LINK | ||
| KEGG ID | hsa8737 | ||
| TTD ID | T99340 | ||
| Pfam | PF00069; PF00531; PF01163; PF03109; PF06293; PF07714; PF12721; PF14531 | ||
| Pair Name | Delta-Tocotrienol, Docetaxel | |||
| Phytochemical | Delta-Tocotrienol | |||
| Drug | Docetaxel | |||
| Disease Info | [ICD-11: 2C82] | Prostate cancer | Investigative | |
| Regulate Info | Up-regulation | Receptor-interacting serine/threonine-protein kinase 1 | Phosphorylation | |
| Result | The ability of δ-TT to induce necroptotic cell death may represent a promising therapeutical approach to overcome DTX chemoresistance in PCa. | |||
| Pair Name | Delta-Tocotrienol, Docetaxel | |||
| Phytochemical | Delta-Tocotrienol | |||
| Drug | Docetaxel | |||
| Disease Info | [ICD-11: 2C82] | Prostate cancer | Investigative | |
| Regulate Info | Up-regulation | Receptor-interacting serine/threonine-protein kinase 1 | Phosphorylation | |
| Result | The ability of δ-TT to induce necroptotic cell death may represent a promising therapeutical approach to overcome DTX chemoresistance in PCa. | |||
| Pair Name | Gambogenic acid, Fluorouracil | |||
| Phytochemical | Gambogenic acid | |||
| Drug | Fluorouracil | |||
| Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
| Regulate Info | Up-regulation | Receptor-interacting serine/threonine-protein kinase 1 | Expression | |
| Result | These mechanisms may be due to the toxicity of targeted toxin to mitochondria via the mitochondrial pathway. | |||
| Pair Name | Piperlongumine, Cisplatin | |||
| Phytochemical | Piperlongumine | |||
| Drug | Cisplatin | |||
| Disease Info | [ICD-11: 2C94] | Bladder cancer | Investigative | |
| Regulate Info | Up-regulation | Receptor-interacting serine/threonine-protein kinase 1 | Activity | |
| Result | Our results demonstrated the role of RIPK1 in cisplatin-resistant cells and the sensitization effect of the natural drug PL on bladder cancer. These may provide a new treatment strategy for overcoming cisplatin resistance in bladder cancer. | |||
| Pair Name | Zeylenone, Cisplatin | |||
| Phytochemical | Zeylenone | |||
| Drug | Cisplatin | |||
| Disease Info | [ICD-11: 2B51] | Osteosarcoma | Investigative | |
| Regulate Info | Up-regulation | Receptor-interacting serine/threonine-protein kinase 1 | Expression | |
| Result | Zeylenone synergizes with cisplatin in osteosarcoma by enhancing DNA damage, apoptosis, and necrosis via the Hsp90/AKT/GSK3β and Fanconi anaemia pathway | |||
| No. | Title | Href |
|---|---|---|
| 1 | Necroptosis Induced by Delta-Tocotrienol Overcomes Docetaxel Chemoresistance in Prostate Cancer Cells. Int J Mol Sci. 2023 Mar 3;24(5):4923. doi: 10.3390/ijms24054923. | Click |
| 2 | Necroptosis Induced by Delta-Tocotrienol Overcomes Docetaxel Chemoresistance in Prostate Cancer Cells. Int J Mol Sci. 2023 Mar 3;24(5):4923. doi: 10.3390/ijms24054923. | Click |
| 3 | Synergistic effects of 5-fluorouracil and gambogenic acid on A549 cells: activation of cell death caused by apoptotic and necroptotic mechanisms via the ROS-mitochondria pathway. Biol Pharm Bull. 2014;37(8):1259-68. doi: 10.1248/bpb.b13-00972. | Click |
| 4 | Piperlongumine increases the sensitivity of bladder cancer to cisplatin by mitochondrial ROS. J Clin Lab Anal. 2022 Jun;36(6):e24452. doi: 10.1002/jcla.24452. | Click |
| 5 | Zeylenone synergizes with cisplatin in osteosarcoma by enhancing DNA damage, apoptosis, and necrosis via the Hsp90/AKT/GSK3β and Fanconi anaemia pathway. Phytother Res. 2021 Oct;35(10):5899-5918. doi: 10.1002/ptr.7299 | Click |
