| Name | Phosphatidylinositol 3-kinase regulatory subunit alpha | ||
| UniProt ID | A0A2X0SFG1_HUMAN | ||
| Gene Name | PIK3R1 | ||
| Gene ID | 5295 | ||
| Synonyms |
PIK3R1, AGM7, GRB1, IMD36, p85, p85-ALPHA, p85alpha
|
||
| Sequence |
MSAEGYQYRALYDYKKEREEDIDLHLGDILTVNKGSLVALGFSDGQEARPEEIGWLNGYN
ETTGERGDFPGTYVEYIGRKKISPPTPKPRPPRPLPVAPGSSKTEADVEQQALTLPDLAE QFAPPDIAPPLLIKLVEAIEKKGLECSTLYRTQSSSNLAELRQLLDCDTPSVDLEMIDVH VLADAFKRYLLDLPNPVIPAAVYSEMISLAPEVQSSEEYIQLLKKLIRSPSIPHQYWLTL QYLLKHFFKLSQTSSKNLLNARVLSEIFSPMLFRFSAASSDNTENLIKVIEILISTEWNE RQPAPALPPKPPKPTTVANNGMNNNMSLQDAEWYWGDISREEVNEKLRDTADGTFLVRDA STKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFSSVVELINHYRNESLAQYNPKL DVKLLYPVSKYQQDQVVKEDNIEAVGKKLHEYNTQFQEKSREYDRLYEEYTRTSQEIQMK RTAIEAFNETIKIFEEQCQTQERYSKEYIEKFKREGNEKEIQRIMHNYDKLKSRISEIID SRRRLEEDLKKQAAEYREIDKRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKKLNEWLGN ENTEDQYSLVEDDEDLPHHDEKTWNVGSSNRNKAENLLRGKRDGTFLVRESSKQGCYACS VVVDGEVKHCVINKTATGYGFAEPYNLYSSLKELVLHYQHTSLVQHNDSLNVTLAYPVYA QQRR |
||
| Pathway Map | MAP LINK | ||
| KEGG ID | hsa5295 | ||
| Pfam | PF00017; PF00018; PF00620; PF06008; PF07653; PF14604; PF16454 | ||
| Pair Name | Withaferin A, Oxaliplatin | |||
| Phytochemical Name | Withaferin A | |||
| Anticancer drug Name | Oxaliplatin | |||
| Disease Info | [ICD-11: 2C10.Z] | Pancreatic cancer | Investigative | |
| Regulate Info | Down-regulation | Phosphatidylinositol 3-kinase regulatory subunit alpha | Phosphorylation | |
| Result | These results support the notion that combination treatment with oxaliplatin and WA could facilitate development of an effective strategy for PC treatment. | |||
| Pair Name | Beta-Elemene, Fluorouracil | |||
| Phytochemical | Beta-Elemene | |||
| Drug | Fluorouracil | |||
| Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
| Regulate Info | Down-regulation | Phosphatidylinositol 3-kinase regulatory subunit alpha | Expression | |
| Result | The conclusion obtained, considering that the results suggest that the combination may be important specifically in the treatment of TNBC. | |||
| Pair Name | Furanodiene, Doxorubicin | |||
| Phytochemical | Furanodiene | |||
| Drug | Doxorubicin | |||
| Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
| Regulate Info | Down-regulation | Phosphatidylinositol 3-kinase regulatory subunit alpha | Phosphorylation | |
| Result | These observations indicate that furanodiene is a potential agent that may be utilized to improve the anticancer efficacy of doxorubicin and overcome the risk of chemotherapy in highly metastatic breast cancer. | |||
| No. | Title | Href |
|---|---|---|
| 1 | Synergistic antitumor activity of withaferin A combined with oxaliplatin triggers reactive oxygen species-mediated inactivation of the PI3K/AKT pathway in human pancreatic cancer cells. Cancer Lett. 2015 Feb 1;357(1):219-230. doi: 10.1016/j.canlet.2014.11.026. | Click |
| 2 | β-Elemene Enhances the Chemotherapeutic Effect of 5-Fluorouracil in Triple-Negative Breast Cancer via PI3K/AKT, RAF-MEK-ErK, and NF-κB Signaling Pathways. Onco Targets Ther. 2020 Jun 9;13:5207-5222. doi: 10.2147/OTT.S242820. | Click |
| 3 | Combined effects of furanodiene and doxorubicin on the migration and invasion of MDA-MB-231 breast cancer cells in vitro. Oncol Rep. 2017 Apr;37(4):2016-2024. doi: 10.3892/or.2017.5435. | Click |
