
| Name | Matrix metalloproteinase-7 | ||
| UniProt ID | MMP7_HUMAN | ||
| Gene Name | MMP7 | ||
| Gene ID | 4316 | ||
| Synonyms |
MMP7, MMP-7, MPSL1, PUMP-1
|
||
| Sequence |
MRLTVLCAVCLLPGSLALPLPQEAGGMSELQWEQAQDYLKRFYLYDSETKNANSLEAKLK
EMQKFFGLPITGMLNSRVIEIMQKPRCGVPDVAEYSLFPNSPKWTSKVVTYRIVSYTRDL PHITVDRLVSKALNMWGKEIPLHFRKVVWGTADIMIGFARGAHGDSYPFDGPGNTLAHAF APGTGLGGDAHFDEDERWTDGSSLGINFLYAATHELGHSLGMGHSSDPNAVMYPTYGNGD PQNFKLSQDDIKGIQKLYGKRSNSRKK |
||
| Pathway Map | MAP LINK | ||
| T.C. Number | 1.W.9.1.2 | ||
| KEGG ID | hsa4316 | ||
| TTD ID | T73475 | ||
| Pfam | PF00413; PF01471; PF07998; PF10462; PF12044; PF12388; PF13582; PF13688 | ||
| Pair Name | Oleuropein, Cisplatin | |||
| Phytochemical | Oleuropein | |||
| Drug | Cisplatin | |||
| Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
| Regulate Info | Down-regulation | Matrix metalloproteinase-7 | Expression | |
| Result | Our results showed for the first time that the anti-tumor activity of oleuropein against HCC could be attributed to influencing the pro-NGF/NGF balance via affecting MMP-7 activity without affecting the gene expression of NGF. Concurrent treatment with both oleuropein and cisplatin could lead to more effective chemotherapeutic combination against HCC. | |||
| Pair Name | Brassinolid, Doxorubicin | |||
| Phytochemical | Brassinolid | |||
| Drug | Doxorubicin | |||
| Disease Info | [ICD-11: 2C25.Z] | Lung cancer | Investigative | |
| Regulate Info | Down-regulation | Matrix metalloproteinase-7 | Expression | |
| Result | These data indicate that EB, a natural product with widespread occurrence in plants, is pharmacologically active in both drug-sensitive and drug-resistant SCLC cells and acts through the Wnt signaling pathway. | |||
| Pair Name | Platycodin D, Cetuximab | |||
| Phytochemical | Platycodin D | |||
| Drug | Cetuximab | |||
| Disease Info | [ICD-11: 2B91.Z] | Colorectal cancer | Investigative | |
| Regulate Info | Down-regulation | Matrix metalloproteinase-7 | Expression | |
| Result | Our findings provide a potential strategy to inhibit CRC metastasis during cetuximab therapy by addition of platycodin D. | |||
| No. | Title | Href |
|---|---|---|
| 1 | Oleuropein potentiates anti-tumor activity of cisplatin against HepG2 through affecting proNGF/NGF balance. Life Sci. 2018 Apr 1;198:87-93. doi: 10.1016/j.lfs.2018.02.027. | Click |
| 2 | The effect of brassinolide, a plant steroid hormone, on drug resistant small-cell lung carcinoma cells. Biochem Biophys Res Commun. 2017 Nov 4;493(1):783-787. doi: 10.1016/j.bbrc.2017.08.094. | Click |
| 3 | Platycodin D represses β-catenin to suppress metastasis of cetuximab-treated KRAS wild-type colorectal cancer cells. Clin Exp Metastasis. 2023 Aug;40(4):339-356. doi: 10.1007/s10585-023-10218-6. | Click |