TOP
Nav Bar
  1. General Info
  2. Effects Info
  3. Reference
Molecular Details
01. General Information
Name Interferon gamma
UniProt ID IFNG_HUMAN
Gene Name IFNG
Gene ID 3458
Synonyms
IFNG, IFG, IFI, IMD69
Sequence
MKYTSYILAFQLCIVLGSLGCYCQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWK
EESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTN
YSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ
Pathway Map MAP LINK
KEGG ID hsa3458
TTD ID T77664
Pfam PF00714; PF05738; PF08581
02. Combinatorial Therapeutic Effect(s)
Synergistic Effect
Hide/Show
Enhancing Drug Efficacy
Hide/Show
Combination Pair ID: 517
Pair Name All-trans retinoic acid, Anti-PD-L1 antibody
Phytochemical All-trans-retinoic acid
Drug Anti-PD-L1 antibody
Disease Info [ICD-11: 2C77] Cervical cancer Investigative
Regulate Info Up-regulation Interferon gamma Expression
Result Inhibition of myeloid-derived suppressive cell function with all-trans retinoic acid enhanced anti-PD-L1 efficacy in cervical cancer.
Combination Pair ID: 3
Pair Name Camptothecin, Camptosar
Phytochemical Camptothecin
Drug Camptosar
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation Interferon gamma Expression
Result Camptothesome Potentiates PD-L1 Immune Checkpoint Blockade for Improved Metastatic Triple-Negative Breast Cancer Immunochemotherapy
Combination Pair ID: 228
Pair Name Carnosic acid, Cisplatin
Phytochemical Carnosic acid
Drug Cisplatin
Disease Info [ICD-11: 2C25] Lung cancer Investigative
Regulate Info Up-regulation Interferon gamma Expression
Result Our study proved that the functional suppression of MDSC by carnosic acid promoted the lethality of CD8 T cells, which contributed to the enhancement of anti-lung cancer effect of cisplatin.
Combination Pair ID: 404
Pair Name Curcumin, Docetaxel
Phytochemical Curcumin
Drug Docetaxel
Disease Info [ICD-11: 2C31.Z] Head and neck squamous cell carcinoma Investigative
Regulate Info Up-regulation Interferon gamma Expression
Result Curcumin Enhances the Efficacy of Docetaxel by Promoting Anti-Tumor Immune Response in Head and Neck Squamous Cell Carcinoma
Combination Pair ID: 578
Pair Name lambda-Carrageenan Oligosaccharides, Fluorouracil
Phytochemical lambda-Carrageenan Oligosaccharides
Drug Fluorouracil
Disease Info [ICD-11: 2B72] Gastric cancer Investigative
Regulate Info Up-regulation Interferon gamma Expression
Result These findings suggested that λ-COS could be used as an immune-modulating agent for chemotherapy.
Combination Pair ID: 494
Pair Name Lycopene, Anti-PD-1 antibody
Phytochemical Lycopene
Drug Anti-PD-1 antibody
Disease Info [ICD-11: 2C25] Lung cancer Investigative
Regulate Info Up-regulation Interferon gamma Expression
Result lycopene promoted anti-PD-1 therapeutic efficiency of lung cancer by promoting IFNγ-expressing CD8+ cells infiltrated in tumor tissues and increasing IFNγ expression in tumor cells.
Combination Pair ID: 975
Pair Name Quercetin, Anti-PD-1 antibody
Phytochemical Quercetin
Drug Anti-PD-1 antibody
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Up-regulation Interferon gamma Expression
Result Quercetin/anti-PD-1 antibody combination therapy reshaped HCC tumor microenvironment in mice in parallel with regulating the GM and macrophage immunity.
Combination Pair ID: 778
Pair Name Rosmarinic acid, Indoleamine 2,3-dioxygenase 1
Phytochemical Rosmarinic acid
Drug Indoleamine 2,3-dioxygenase 1
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Up-regulation Interferon gamma Expression
Result The mechanism might be related to regulating immune response and immunocytokines, as well as alleviating immunosuppression induced by Tregs in the tumor immune microenvironment.
03. Reference
No. Title Href
1 Inhibition of myeloid-derived suppressive cell function with all-trans retinoic acid enhanced anti-PD-L1 efficacy in cervical cancer. Sci Rep. 2022 Jun 10;12(1):9619. doi: 10.1038/s41598-022-13855-1. Click
2 Camptothesome Potentiates PD-L1 Immune Checkpoint Blockade for Improved Metastatic Triple-Negative Breast Cancer Immunochemotherapy. Mol Pharm. 2022 Dec 5;19(12):4665-4674. doi: 10.1021/acs.molpharmaceut.2c00701. Click
3 Carnosic acid enhances the anti-lung cancer effect of cisplatin by inhibiting myeloid-derived suppressor cells. Chin J Nat Med. 2018 Dec;16(12):907-915. doi: 10.1016/S1875-5364(18)30132-8. Click
4 Curcumin Enhances the Efficacy of Docetaxel by Promoting Anti-Tumor Immune Response in Head and Neck Squamous Cell Carcinoma. Cancer Invest. 2023 May;41(5):524-533. doi: 10.1080/07357907.2023.2194420. Click
5 The Antitumor Potential of λ-Carrageenan Oligosaccharides on Gastric Carcinoma by Immunomodulation. Nutrients. 2023 Apr 24;15(9):2044. doi: 10.3390/nu15092044. Click
6 Lycopene improves the efficiency of anti-PD-1 therapy via activating IFN signaling of lung cancer cells. Cancer Cell Int. 2019 Mar 21;19:68. doi: 10.1186/s12935-019-0789-y. Click
7 Quercetin/Anti-PD-1 Antibody Combination Therapy Regulates the Gut Microbiota, Impacts Macrophage Immunity and Reshapes the Hepatocellular Carcinoma Tumor Microenvironment. Front Biosci (Landmark Ed). 2023 Dec 1;28(12):327. doi: 10.31083/j.fbl2812327. Click
8 Effects of gene silencing of indoleamine 2,3-dioxygenase 1 combined with rosmarinic acid on tumor immune microenvironment in H22 tumor-bearing mice. Int Immunopharmacol. 2023 Jun;119:110193. doi: 10.1016/j.intimp.2023.110193. Click
It has been 58489 visits since 2024.08
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang
TOP