| Name | Interferon gamma | ||
| UniProt ID | IFNG_HUMAN | ||
| Gene Name | IFNG | ||
| Gene ID | 3458 | ||
| Synonyms |
IFNG, IFG, IFI, IMD69
|
||
| Sequence |
MKYTSYILAFQLCIVLGSLGCYCQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWK
EESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTN YSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ |
||
| Pathway Map | MAP LINK | ||
| KEGG ID | hsa3458 | ||
| TTD ID | T77664 | ||
| Pfam | PF00714; PF05738; PF08581 | ||
| Pair Name | Camptothecin, Camptosar | |||
| Phytochemical | Camptothecin | |||
| Drug | Camptosar | |||
| Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
| Regulate Info | Up-regulation | Interferon gamma | Expression | |
| Result | Camptothesome Potentiates PD-L1 Immune Checkpoint Blockade for Improved Metastatic Triple-Negative Breast Cancer Immunochemotherapy | |||
| Pair Name | Quercetin, Anti-PD-1 antibody | |||
| Phytochemical | Quercetin | |||
| Drug | Anti-PD-1 antibody | |||
| Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
| Regulate Info | Up-regulation | Interferon gamma | Expression | |
| Result | Quercetin/anti-PD-1 antibody combination therapy reshaped HCC tumor microenvironment in mice in parallel with regulating the GM and macrophage immunity. | |||
| Pair Name | Carnosic acid, Cisplatin | |||
| Phytochemical | Carnosic acid | |||
| Drug | Cisplatin | |||
| Disease Info | [ICD-11: 2C25.Z] | Lung cancer | Investigative | |
| Regulate Info | Up-regulation | Interferon gamma | Expression | |
| Result | Our study proved that the functional suppression of MDSC by carnosic acid promoted the lethality of CD8 T cells, which contributed to the enhancement of anti-lung cancer effect of cisplatin. | |||
| Pair Name | Rosmarinic acid, Indoleamine 2,3-dioxygenase 1 | |||
| Phytochemical | Rosmarinic acid | |||
| Drug | Indoleamine 2,3-dioxygenase 1 | |||
| Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
| Regulate Info | Up-regulation | Interferon gamma | Expression | |
| Result | The mechanism might be related to regulating immune response and immunocytokines, as well as alleviating immunosuppression induced by Tregs in the tumor immune microenvironment. | |||
| Pair Name | Curcumin, Docetaxel | |||
| Phytochemical | Curcumin | |||
| Drug | Docetaxel | |||
| Disease Info | [ICD-11: 2C31.Z] | Head and neck squamous cell carcinoma | Investigative | |
| Regulate Info | Up-regulation | Interferon gamma | Expression | |
| Result | Curcumin Enhances the Efficacy of Docetaxel by Promoting Anti-Tumor Immune Response in Head and Neck Squamous Cell Carcinoma | |||
| Pair Name | All-trans retinoic acid, Anti-PD-L1 antibody | |||
| Phytochemical | All-trans-retinoic acid | |||
| Drug | Anti-PD-L1 antibody | |||
| Disease Info | [ICD-11: 2C77.Z] | Cervical cancer | Investigative | |
| Regulate Info | Up-regulation | Interferon gamma | Expression | |
| Result | Inhibition of myeloid-derived suppressive cell function with all-trans retinoic acid enhanced anti-PD-L1 efficacy in cervical cancer. | |||
| Pair Name | Lycopene, Anti-PD-1 antibody | |||
| Phytochemical | Lycopene | |||
| Drug | Anti-PD-1 antibody | |||
| Disease Info | [ICD-11: 2C25.Z] | Lung cancer | Investigative | |
| Regulate Info | Up-regulation | Interferon gamma | Expression | |
| Result | lycopene promoted anti-PD-1 therapeutic efficiency of lung cancer by promoting IFNγ-expressing CD8+ cells infiltrated in tumor tissues and increasing IFNγ expression in tumor cells. | |||
| Pair Name | lambda-Carrageenan Oligosaccharides, Fluorouracil | |||
| Phytochemical | lambda-Carrageenan Oligosaccharides | |||
| Drug | Fluorouracil | |||
| Disease Info | [ICD-11: 2B72.Z] | Gastric cancer | Investigative | |
| Regulate Info | Up-regulation | Interferon gamma | Expression | |
| Result | These findings suggested that λ-COS could be used as an immune-modulating agent for chemotherapy. | |||
| No. | Title | Href |
|---|---|---|
| 1 | Camptothesome Potentiates PD-L1 Immune Checkpoint Blockade for Improved Metastatic Triple-Negative Breast Cancer Immunochemotherapy. Mol Pharm. 2022 Dec 5;19(12):4665-4674. doi: 10.1021/acs.molpharmaceut.2c00701. | Click |
| 2 | Quercetin/Anti-PD-1 Antibody Combination Therapy Regulates the Gut Microbiota, Impacts Macrophage Immunity and Reshapes the Hepatocellular Carcinoma Tumor Microenvironment. Front Biosci (Landmark Ed). 2023 Dec 1;28(12):327. doi: 10.31083/j.fbl2812327. | Click |
| 3 | Carnosic acid enhances the anti-lung cancer effect of cisplatin by inhibiting myeloid-derived suppressor cells. Chin J Nat Med. 2018 Dec;16(12):907-915. doi: 10.1016/S1875-5364(18)30132-8. | Click |
| 4 | Effects of gene silencing of indoleamine 2,3-dioxygenase 1 combined with rosmarinic acid on tumor immune microenvironment in H22 tumor-bearing mice. Int Immunopharmacol. 2023 Jun;119:110193. doi: 10.1016/j.intimp.2023.110193. | Click |
| 5 | Curcumin Enhances the Efficacy of Docetaxel by Promoting Anti-Tumor Immune Response in Head and Neck Squamous Cell Carcinoma. Cancer Invest. 2023 May;41(5):524-533. doi: 10.1080/07357907.2023.2194420. | Click |
| 6 | Inhibition of myeloid-derived suppressive cell function with all-trans retinoic acid enhanced anti-PD-L1 efficacy in cervical cancer. Sci Rep. 2022 Jun 10;12(1):9619. doi: 10.1038/s41598-022-13855-1. | Click |
| 7 | Lycopene improves the efficiency of anti-PD-1 therapy via activating IFN signaling of lung cancer cells. Cancer Cell Int. 2019 Mar 21;19:68. doi: 10.1186/s12935-019-0789-y. | Click |
| 8 | The Antitumor Potential of λ-Carrageenan Oligosaccharides on Gastric Carcinoma by Immunomodulation. Nutrients. 2023 Apr 24;15(9):2044. doi: 10.3390/nu15092044. | Click |
