InterPAD - DETAILS

MEASALTSSAVTSVAKVVRVASGSAVVLPLARIATVVIGGVVAMAAVPMVLSAMGFTAAG
IASSSIAAKMMSAAAIANGGGVASGSLVATLQSLGATGLSGLTKFILGSIGSAIAAVIAR
FY

No.	Title	Href
1	Sensitization of lung cancer cells to cisplatin by β-elemene is mediated through blockade of cell cycle progression: antitumor efficacies of β-elemene and its synthetic analogs. Med Oncol. 2013 Mar;30(1):488. doi: 10.1007/s12032-013-0488-9.	`Click`
2	Synergistic anticancer activity of capsaicin and 3,3'-diindolylmethane in human colorectal cancer. J Agric Food Chem. 2015 May 6;63(17):4297-304. doi: 10.1021/jf506098s.	`Click`
3	Antitumor effects and the underlying mechanism of licochalcone A combined with 5-fluorouracil in gastric cancer cells. Oncol Lett. 2017 Mar;13(3):1695-1701. doi: 10.3892/ol.2017.5614.	`Click`
4	Pterostilbine, an active component of blueberries, sensitizes colon cancer cells to 5-fluorouracil cytotoxicity. Sci Rep. 2015 Oct 16;5:15239. doi: 10.1038/srep15239.	`Click`

No.

Title

Href

Sensitization of lung cancer cells to cisplatin by β-elemene is mediated through blockade of cell cycle progression: antitumor efficacies of β-elemene and its synthetic analogs. Med Oncol. 2013 Mar;30(1):488. doi: 10.1007/s12032-013-0488-9.

Click

Synergistic anticancer activity of capsaicin and 3,3'-diindolylmethane in human colorectal cancer. J Agric Food Chem. 2015 May 6;63(17):4297-304. doi: 10.1021/jf506098s.

Click

Antitumor effects and the underlying mechanism of licochalcone A combined with 5-fluorouracil in gastric cancer cells. Oncol Lett. 2017 Mar;13(3):1695-1701. doi: 10.3892/ol.2017.5614.

Click

Pterostilbine, an active component of blueberries, sensitizes colon cancer cells to 5-fluorouracil cytotoxicity. Sci Rep. 2015 Oct 16;5:15239. doi: 10.1038/srep15239.

Click

Name	Interferon alpha-inducible protein 27
UniProt ID	IFI27_HUMAN
Gene Name	IFI27
Gene ID	3429
Synonyms	IFI27, FAM14D, ISG12, ISG12A, P27
Sequence	MEASALTSSAVTSVAKVVRVASGSAVVLPLARIATVVIGGVVAMAAVPMVLSAMGFTAAG IASSSIAAKMMSAAAIANGGGVASGSLVATLQSLGATGLSGLTKFILGSIGSAIAAVIAR FY
Pathway Map	`MAP LINK`
KEGG ID	hsa3429
Pfam	PF06140

Pair Name	Beta-Elemene, Cisplatin
Phytochemical	Beta-Elemene
Drug	Cisplatin
Disease Info	[ICD-11: 2C25]	Lung cancer	Investigative
Regulate Info	Up-regulation	Interferon alpha-inducible protein 27	Expression
Result	β-elemenal may have greater potential as an anticancer alternative to β-elemene in treating lung cancer and other tumors.

Pair Name	Capsaicin, 3,3'-diindolylmethane
Phytochemical	Capsaicin
Drug	3,3'-diindolylmethane
Disease Info	[ICD-11: 2B90]	Colon cancer	Investigative
Regulate Info	Up-regulation	Interferon alpha-inducible protein 27	Expression
Result	The present study suggests capsaicin and DIM work synergistically to inhibit cell proliferation and induce apoptosis in colorectal cancer through modulating transcriptional activity of NF-κB, p53, and target genes associated with apoptosis.

Pair Name	Licochalcone A, Fluorouracil
Phytochemical	Licochalcone A
Drug	Fluorouracil
Disease Info	[ICD-11: 2B72]	Gastric cancer	Investigative
Regulate Info	Up-regulation	Interferon alpha-inducible protein 27	Expression
Result	LCA alone or in combination with 5-FU may have significant anticancer effects on gastric cancer cells

Pair Name	Pterostilbene, Fluorouracil
Phytochemical	Pterostilbene
Drug	Fluorouracil
Disease Info	[ICD-11: 2B90]	Colon cancer	Investigative
Regulate Info	Up-regulation	Interferon alpha-inducible protein 27	Expression
Result	These results provide a rationale for novel combination treatment strategies, especially for patients with 5-FU-resistant tumors expressing ER-β protein.