Name | Interferon alpha-inducible protein 27 | ||
UniProt ID | IFI27_HUMAN | ||
Gene Name | IFI27 | ||
Gene ID | 3429 | ||
Synonyms |
IFI27, FAM14D, ISG12, ISG12A, P27
|
||
Sequence |
MEASALTSSAVTSVAKVVRVASGSAVVLPLARIATVVIGGVVAMAAVPMVLSAMGFTAAG
IASSSIAAKMMSAAAIANGGGVASGSLVATLQSLGATGLSGLTKFILGSIGSAIAAVIAR FY |
||
Pathway Map | MAP LINK | ||
KEGG ID | hsa3429 | ||
Pfam | PF06140 |
Pair Name | Licochalcone A, Fluorouracil | |||
Phytochemical | Licochalcone A | |||
Drug | Fluorouracil | |||
Disease Info | [ICD-11: 2B72.Z] | Gastric cancer | Investigative | |
Regulate Info | Up-regulation | Interferon alpha-inducible protein 27 | Expression | |
Result | LCA alone or in combination with 5-FU may have significant anticancer effects on gastric cancer cells |
Pair Name | Beta-Elemene, Cisplatin | |||
Phytochemical | Beta-Elemene | |||
Drug | Cisplatin | |||
Disease Info | [ICD-11: 2C25.Z] | Lung cancer | Investigative | |
Regulate Info | Up-regulation | Interferon alpha-inducible protein 27 | Expression | |
Result | β-elemenal may have greater potential as an anticancer alternative to β-elemene in treating lung cancer and other tumors. |
Pair Name | Pterostilbene, Fluorouracil | |||
Phytochemical | Pterostilbene | |||
Drug | Fluorouracil | |||
Disease Info | [ICD-11: 2B90.Z] | Colon cancer | Investigative | |
Regulate Info | Up-regulation | Interferon alpha-inducible protein 27 | Expression | |
Result | These results provide a rationale for novel combination treatment strategies, especially for patients with 5-FU-resistant tumors expressing ER-β protein. |
Pair Name | Capsaicin, 3,3'-diindolylmethane | |||
Phytochemical | Capsaicin | |||
Drug | 3,3'-diindolylmethane | |||
Disease Info | [ICD-11: 2B90.Z] | Colon cancer | Investigative | |
Regulate Info | Up-regulation | Interferon alpha-inducible protein 27 | Expression | |
Result | The present study suggests capsaicin and DIM work synergistically to inhibit cell proliferation and induce apoptosis in colorectal cancer through modulating transcriptional activity of NF-κB, p53, and target genes associated with apoptosis. |
No. | Title | Href |
---|---|---|
1 | Antitumor effects and the underlying mechanism of licochalcone A combined with 5-fluorouracil in gastric cancer cells. Oncol Lett. 2017 Mar;13(3):1695-1701. doi: 10.3892/ol.2017.5614. | Click |
2 | Sensitization of lung cancer cells to cisplatin by β-elemene is mediated through blockade of cell cycle progression: antitumor efficacies of β-elemene and its synthetic analogs. Med Oncol. 2013 Mar;30(1):488. doi: 10.1007/s12032-013-0488-9. | Click |
3 | Pterostilbine, an active component of blueberries, sensitizes colon cancer cells to 5-fluorouracil cytotoxicity. Sci Rep. 2015 Oct 16;5:15239. doi: 10.1038/srep15239. | Click |
4 | Synergistic anticancer activity of capsaicin and 3,3'-diindolylmethane in human colorectal cancer. J Agric Food Chem. 2015 May 6;63(17):4297-304. doi: 10.1021/jf506098s. | Click |