TOP
Nav Bar
  1. General Info
  2. Effects Info
  3. Reference
Molecular Details
01. General Information
Name Interferon alpha-inducible protein 27
UniProt ID IFI27_HUMAN
Gene Name IFI27
Gene ID 3429
Synonyms
IFI27, FAM14D, ISG12, ISG12A, P27
Sequence
MEASALTSSAVTSVAKVVRVASGSAVVLPLARIATVVIGGVVAMAAVPMVLSAMGFTAAG
IASSSIAAKMMSAAAIANGGGVASGSLVATLQSLGATGLSGLTKFILGSIGSAIAAVIAR
FY
Pathway Map MAP LINK
KEGG ID hsa3429
Pfam PF06140
02. Combinatorial Therapeutic Effect(s)
Synergistic Effect
Hide/Show
Enhancing Drug Efficacy
Hide/Show
Combination Pair ID: 702
Pair Name Beta-Elemene, Cisplatin
Phytochemical Beta-Elemene
Drug Cisplatin
Disease Info [ICD-11: 2C25] Lung cancer Investigative
Regulate Info Up-regulation Interferon alpha-inducible protein 27 Expression
Result β-elemenal may have greater potential as an anticancer alternative to β-elemene in treating lung cancer and other tumors.
Combination Pair ID: 831
Pair Name Capsaicin, 3,3'-diindolylmethane
Phytochemical Capsaicin
Drug 3,3'-diindolylmethane
Disease Info [ICD-11: 2B90] Colon cancer Investigative
Regulate Info Up-regulation Interferon alpha-inducible protein 27 Expression
Result The present study suggests capsaicin and DIM work synergistically to inhibit cell proliferation and induce apoptosis in colorectal cancer through modulating transcriptional activity of NF-κB, p53, and target genes associated with apoptosis.
Combination Pair ID: 651
Pair Name Licochalcone A, Fluorouracil
Phytochemical Licochalcone A
Drug Fluorouracil
Disease Info [ICD-11: 2B72] Gastric cancer Investigative
Regulate Info Up-regulation Interferon alpha-inducible protein 27 Expression
Result LCA alone or in combination with 5-FU may have significant anticancer effects on gastric cancer cells
Combination Pair ID: 805
Pair Name Pterostilbene, Fluorouracil
Phytochemical Pterostilbene
Drug Fluorouracil
Disease Info [ICD-11: 2B90] Colon cancer Investigative
Regulate Info Up-regulation Interferon alpha-inducible protein 27 Expression
Result These results provide a rationale for novel combination treatment strategies, especially for patients with 5-FU-resistant tumors expressing ER-β protein.
03. Reference
No. Title Href
1 Sensitization of lung cancer cells to cisplatin by β-elemene is mediated through blockade of cell cycle progression: antitumor efficacies of β-elemene and its synthetic analogs. Med Oncol. 2013 Mar;30(1):488. doi: 10.1007/s12032-013-0488-9. Click
2 Synergistic anticancer activity of capsaicin and 3,3'-diindolylmethane in human colorectal cancer. J Agric Food Chem. 2015 May 6;63(17):4297-304. doi: 10.1021/jf506098s. Click
3 Antitumor effects and the underlying mechanism of licochalcone A combined with 5-fluorouracil in gastric cancer cells. Oncol Lett. 2017 Mar;13(3):1695-1701. doi: 10.3892/ol.2017.5614. Click
4 Pterostilbine, an active component of blueberries, sensitizes colon cancer cells to 5-fluorouracil cytotoxicity. Sci Rep. 2015 Oct 16;5:15239. doi: 10.1038/srep15239. Click
It has been 162705 visits since 2024.08
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang
TOP