
| Name | Histone H3.2 | ||
| UniProt ID | H32_HUMAN | ||
| Gene Name | H3C14 | ||
| Gene ID | 126961 | ||
| Synonyms |
H3C14, H3, H3.2, H3/M, H3C13, H3C15, H3F2, H3FM, H3FN, HIST2H3C
|
||
| Sequence |
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA |
||
| Pathway Map | MAP LINK | ||
| KEGG ID | hsa126961 | ||
| Pfam | PF00125; PF00808; PF02291; PF15511; PF15630; PF15715; PF21150 | ||
| Pair Name | Homoharringtonine, Suberoylanilide hydroxamic acid (SAHA) | |||
| Phytochemical | Homoharringtonine | |||
| Drug | Suberoylanilide hydroxamic acid (SAHA) | |||
| Disease Info | [ICD-11: 2A60.Z] | Acute myeloid leukemia | Investigative | |
| Regulate Info | Up-regulation | Histone H3.2 | Acetylation | |
| Result | The synergistic effect between HHT and SAHA was blocked partially using a specific anti‑TRAIL antibody. The combination therapy was also found to significantly inhibit the growth of leukemia xenografts in vivo with enhanced apoptosis. These results indicate that, by regulating the induction of TRAIL and activation of the TRAIL apoptotic pathway, it is possible to administer HHT at low concentrations in combination with SAHA as an effective therapeutic approach for the treatment of AML. | |||
| Pair Name | Betulinic acid, Imatinib | |||
| Phytochemical | Betulinic acid | |||
| Drug | Imatinib | |||
| Disease Info | [ICD-11: 2B33.2] | Chronic myeloid leukemia | Investigative | |
| Regulate Info | Up-regulation | Histone H3.2 | Acetylation | |
| Result | Our findings demonstrated that HDAC3 is an essential factor in BCR-ABL1 kinase-independent IM resistance, and that BA in combination with IM may be a novel treatment strategy for overcoming IM resistance in CML. | |||
| Pair Name | Sulforaphane, Everolimus | |||
| Phytochemical | Sulforaphane | |||
| Drug | Everolimus | |||
| Disease Info | [ICD-11: 2C94.Z] | Bladder cancer | Investigative | |
| Regulate Info | Up-regulation | Histone H3.2 | Expression | |
| Result | The addition of SFN to the long-term everolimus application inhibits resistance development in bladder cancer cells in vitro. Therefore, sulforaphane may hold potential for treating bladder carcinoma in patients with resistance to an mTOR inhibitor. | |||
| No. | Title | Href |
|---|---|---|
| 1 | Homoharringtonine and SAHA synergistically enhance apoptosis in human acute myeloid leukemia cells through upregulation of TRAIL and death receptors. Mol Med Rep. 2013 Jun;7(6):1838-44. doi: 10.3892/mmr.2013.1440. | Click |
| 2 | Betulinic acid restores imatinib sensitivity in BCR-ABL1 kinase-independent, imatinib-resistant chronic myeloid leukemia by increasing HDAC3 ubiquitination and degradation. Ann N Y Acad Sci. 2020 May;1467(1):77-93. doi: 10.1111/nyas.14298. | Click |
| 3 | Chronic Sulforaphane Administration Inhibits Resistance to the mTOR-Inhibitor Everolimus in Bladder Cancer Cells. Int J Mol Sci. 2020 Jun 4;21(11):4026. doi: 10.3390/ijms21114026. | Click |